KEGG   Prochlorococcus marinus NATL1A: NATL1_15431Help
Entry
NATL1_15431       CDS       T00467                                 

Definition
pfkB family carbohydrate kinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pme  Prochlorococcus marinus NATL1A
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pme00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NATL1_15431
Enzymes [BR:pme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     NATL1_15431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1257194..1258036
Genome map
AA seq 280 aa AA seqDB search
MRIDAPKEILSLPNLKLAVIGHVEWVTFLKVDQLPLAGQISHAKDCFEEAAGGAAVAAVQ
MARLINNPVDLITSLGKDNYGEKCYERLTKLGLNLEVAWREKPTRKGISLISKDGERAIT
VIGERLQPIGSDNLPWSDLKNYDGVFITATDKEGIRFARKARFLSATPRTGQQTLKDSKV
KLNALIGSGLDPGEKINYEELEPKPDIYISTKGESGGTIFPENIKYKPITPSSKEIDTYG
CGDSFAGAVTTALSAKLNLEQAINIGAYCGAECSTHYGPY
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgagaattgatgctcctaaagaaatacttagccttcctaaccttaaattagcggtgatc
ggtcatgttgaatgggtaacattcttaaaggttgatcagctcccattagcaggacaaatt
tcgcatgcaaaagattgctttgaagaagcagcaggtggtgcggcagtcgcagctgttcag
atggcaaggctaataaataaccctgttgacttaatcacatcattaggcaaagacaattat
ggtgaaaaatgctacgaaagacttactaaacttggtttaaatttagaagtagcttggcga
gagaaacccaccagaaaaggtattagcctaatcagcaaagatggagaaagagcaattaca
gttattggagaaagattacagccaatcggttctgataatttaccttggagtgacttgaaa
aattacgatggtgttttcattaccgctactgacaaagaaggaataagattcgctaggaaa
gccagattcctctctgcaactccccgaacaggtcaacaaaccctaaaggattcaaaagta
aaactcaatgcattgattggcagtggtcttgatcctggtgaaaagataaattacgaagaa
cttgaacctaaaccagacatatacatttcaacaaaaggtgaatcaggtggaacaattttt
cctgaaaatattaaatacaagcccattacgcctagttctaaagaaatagacacctatggt
tgtggggacagtttcgcgggggctgtgacaactgctctctcagcaaagctaaatttagag
caagcgattaatataggtgcatattgcggtgctgaatgctcaactcattacgggccttac
taa

DBGET integrated database retrieval system