KEGG   Prochlorococcus marinus NATL1A: NATL1_16661Help
Entry
NATL1_16661       CDS       T00467                                 

Gene name
cysQ
Definition
CysQ (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
pme  Prochlorococcus marinus NATL1A
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pme00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    NATL1_16661 (cysQ)
Enzymes [BR:pme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     NATL1_16661 (cysQ)
Transfer RNA biogenesis [BR:pme03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    NATL1_16661 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1358877..1359791)
Genome map
AA seq 304 aa AA seqDB search
MSIDLVVPKEVELPTLLDVLRKLSWASADVLMAYARGDEPPYGFPKSLTVEEGGDGPVSA
ADMAVNELLISGLKDNLAFKEWDILSEETSKEKTFQQDNYKKDWCWILDPLDGTKDFLQG
SENYAVHIALAYKKKPKIGIVLIPEKNELWFGIVGIGAWFENRDGSKNHFSFSDRLDISK
LILVSSKNHQQSKLNNLLSTLCFGETKKIGSVGCKVVSILRGEADVYISLSGKTSPKDWD
MAAPHALIEAAGGMFSHADGKNLIYQETNYSQSGCLIASHGKSHQKICQKAMDFFSLEEP
KYFV
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgtctattgatcttgttgtgccaaaagaggtcgaattaccgactttattggatgtgctt
agaaagcttagctgggcttccgctgatgttttgatggcatatgcaagaggtgatgaacct
ccatatggcttccctaaatcattaactgtagaggaaggcggtgacggcccagtatctgca
gctgacatggcagtgaatgaattattgatctctggattgaaggataatctcgctttcaaa
gaatgggatattttaagcgaagaaacttctaaggagaaaacttttcagcaagataattat
aaaaaagattggtgttggattcttgatccattagatgggacaaaggattttcttcaagga
tctgaaaactatgcagttcatattgctttggcgtacaaaaaaaagccaaaaattgggata
gttttgatacctgaaaagaatgaattatggtttggaattgttggaattggtgcatggttt
gaaaatcgtgatggctctaaaaaccacttttcttttagtgatagattggatatttcgaaa
ttgatactagtttcaagtaaaaatcatcaacaatcaaaacttaataaccttctgtcaact
ctgtgctttggtgagacaaaaaaaataggcagtgtcggttgtaaagttgtctcaattttg
aggggagaagcagatgtttatatctctctatctggaaaaacttcacccaaggattgggat
atggctgctccgcatgctcttattgaggcggctggtggtatgttctctcatgcagatgga
aaaaatttaatttaccaagaaacaaactattctcaatctggttgtttaattgcaagccat
gggaaatctcatcaaaagatttgccaaaaagctatggattttttctctctggaagaacct
aaatacttcgtctaa

DBGET integrated database retrieval system