KEGG   Prochlorococcus marinus NATL1A: NATL1_18891Help
Entry
NATL1_18891       CDS       T00467                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23 1.1.1.37)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
pme  Prochlorococcus marinus NATL1A
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NATL1_18891 (hisD)
  Amino acid metabolism
   00340 Histidine metabolism
    NATL1_18891 (hisD)
Enzymes [BR:pme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     NATL1_18891 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1551192..1552541
Genome map
AA seq 449 aa AA seqDB search
MTQIINKDEVQETSSKKLTIKTANSIDQAQFELRRITERTSGTVQDEAIKVVDDILKNVR
ERGDEALTEYTSRFDGFLTEKFQVSSDLILKAWEETPRELQDSLLLAKKRIEKFHSLQVP
KNITYTGPNGETLGRRWSPVEKAGIYVPGGRAAYPSTVLMNAIPAYVAGVNQIIMVSPAN
SQGEINQTVLAAAHITGINKIFRLGGAQAICALASGTESIPKVDVITGPGNIYVTLAKKK
VYGKVGIDSLAGPSEILIIADQSAKLEHVASDMLAQSEHDPLASAILITTNTKLAEKLPA
EINRQLINHPRLKICQESISNWGLIVLCDDLETCAQLSDTFAPEHLELLVEDPKKLSESI
NNAGAIFMGPWSPEAIGDYLGGPNHTLPTSGTARFAGALGVETFMKNTSLIDFSKEAFNE
NKNAVVQLANSEGLHSHAESIRIRDSKSF
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaaataattaataaagacgaggttcaagaaacctcttcaaaaaaattgaccata
aaaacagctaatagcattgatcaggcacagtttgagctaaggagaattactgagagaaca
tctggaaccgttcaagatgaagctataaaggtagttgacgatattcttaaaaacgtaagg
gaaagaggggatgaagcacttacagaatacacttctcgctttgatggatttctaacggaa
aaatttcaagtttcatcagatttaatactgaaagcttgggaagagactcctagggaactt
caagattcgcttttattggcaaaaaaaagaattgaaaaatttcatagtcttcaggtacca
aaaaatattacttatacaggacccaatggtgaaacacttggaagaagatggagccctgtt
gaaaaagcaggcatttatgttcctggcggaagagccgcctatcccagcactgtgttaatg
aatgctattcctgcttatgttgcaggagtcaatcaaattattatggtttctcctgctaac
tctcaaggagagataaaccaaaccgttttagctgcagcacatattacaggtatcaacaaa
atctttcgtcttggaggcgctcaagctatttgcgcacttgctagtggaactgaatcaatt
ccaaaagtagatgtaattactggaccaggaaatatttatgtaacgttggcaaagaaaaaa
gtttatggaaaggtaggaattgattctttggctggtccaagcgagatcctaataatcgct
gatcaatcagcaaaattagaacatgttgcatctgatatgttagctcagtcagaacatgat
cctttagcctcagcgatactaatcactacaaatacaaaattagctgaaaagttacccgca
gaaattaaccgtcaattaattaatcatccaagattaaaaatatgtcaagaatcaatttcc
aactggggtttaatagtcctttgtgatgatttagaaacttgtgcgcaattgagcgatact
tttgccccagaacatcttgaattacttgtagaggacccaaaaaaattatcagaaagcata
aacaatgctggggcaatatttatgggcccatggagcccagaggctattggagattatctt
ggcgggcctaatcacactcttcccacttctggaactgcaagatttgctggcgctcttgga
gttgaaacttttatgaaaaatacctcacttatagatttttcaaaagaagcatttaatgaa
aataaaaatgcagttgtacaattagccaatagcgagggactacatagtcatgcagaatca
ataagaattagagactctaaatctttttaa

DBGET integrated database retrieval system