KEGG   Prochlorococcus marinus NATL1A: NATL1_19871Help
Entry
NATL1_19871       CDS       T00467                                 

Gene name
rpsE
Definition
30S ribosomal protein S5
Orthology
K02988  
small subunit ribosomal protein S5
Organism
pme  Prochlorococcus marinus NATL1A
Pathway
Ribosome
Class
Genetic Information Processing; Translation; Ribosome [PATH:pme03010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1639342..1639968)
Genome map
AA seq 208 aa AA seqDB search
MTDSNNQSPNKKTSGSSGAPTAADGRQENRRSRGEKRGGRRDRRGQERDSEWQERVVQIR
RVSKTVKGGKKMSFRAIVVVGNEKGQVGVGVGKAGDVIGAVRKGVADGKKHLVRVPLTRN
SSIPTLSNGRDGAASVLIRPAAPGTGVIAGGSIRTVLELAGIKNVLAKRLGSKTPLNNAR
AAMVALSELRTHKATAKERGISLEQIYS
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgacagactctaacaaccagtccccaaataaaaaaacttctggatcatcaggtgctcct
acagcggcagatggtaggcaggaaaatcgtcgcagtcgtggtgaaaaacgcggaggaaga
agagatcgaagaggtcaagaaagagattctgagtggcaagaaagagttgtccaaattaga
agggtttcgaaaacagtcaaaggtggaaaaaaaatgagttttagagcaatagttgtagta
ggcaatgaaaaaggacaagttggagttggtgtaggaaaagccggagatgttattggtgcc
gttcgtaaaggagttgctgatggcaaaaaacatttagttcgtgttcctttaactcgaaat
agttcgatcccaactctctctaacggtagagatggggcagcaagtgtgttgattcgtccc
gcagctcctggaacaggcgtaattgctgggggttcaattcgtactgttttagagttggct
ggaattaagaatgtacttgcaaagcgcttaggcagtaagacccctcttaataatgctcgt
gctgcaatggttgctttaagtgagttaagaactcataaagccacagcaaaagagcgtggt
atttcacttgagcagatttattcctaa

DBGET integrated database retrieval system