KEGG   Prochlorococcus marinus NATL1A: NATL1_19871Help
Entry
NATL1_19871       CDS       T00467                                 

Gene name
rpsE
Definition
30S ribosomal protein S5
Orthology
K02988  
small subunit ribosomal protein S5
Organism
pme  Prochlorococcus marinus NATL1A
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:pme00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    NATL1_19871 (rpsE)
Ribosome [BR:pme03011]
 Ribosomal Proteins
  Mitochondria
   Small subunit
    NATL1_19871 (rpsE)
  Bacteria
    NATL1_19871 (rpsE)
  Archaea
    NATL1_19871 (rpsE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1639342..1639968)
Genome map
AA seq 208 aa AA seqDB search
MTDSNNQSPNKKTSGSSGAPTAADGRQENRRSRGEKRGGRRDRRGQERDSEWQERVVQIR
RVSKTVKGGKKMSFRAIVVVGNEKGQVGVGVGKAGDVIGAVRKGVADGKKHLVRVPLTRN
SSIPTLSNGRDGAASVLIRPAAPGTGVIAGGSIRTVLELAGIKNVLAKRLGSKTPLNNAR
AAMVALSELRTHKATAKERGISLEQIYS
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgacagactctaacaaccagtccccaaataaaaaaacttctggatcatcaggtgctcct
acagcggcagatggtaggcaggaaaatcgtcgcagtcgtggtgaaaaacgcggaggaaga
agagatcgaagaggtcaagaaagagattctgagtggcaagaaagagttgtccaaattaga
agggtttcgaaaacagtcaaaggtggaaaaaaaatgagttttagagcaatagttgtagta
ggcaatgaaaaaggacaagttggagttggtgtaggaaaagccggagatgttattggtgcc
gttcgtaaaggagttgctgatggcaaaaaacatttagttcgtgttcctttaactcgaaat
agttcgatcccaactctctctaacggtagagatggggcagcaagtgtgttgattcgtccc
gcagctcctggaacaggcgtaattgctgggggttcaattcgtactgttttagagttggct
ggaattaagaatgtacttgcaaagcgcttaggcagtaagacccctcttaataatgctcgt
gctgcaatggttgctttaagtgagttaagaactcataaagccacagcaaaagagcgtggt
atttcacttgagcagatttattcctaa

DBGET integrated database retrieval system