KEGG   Prochlorococcus marinus NATL1A: NATL1_19871Help
Entry
NATL1_19871       CDS       T00467                                 

Gene name
rpsE
Definition
(GenBank) 30S ribosomal protein S5
  KO
K02988  small subunit ribosomal protein S5
Organism
pme  Prochlorococcus marinus NATL1A
Pathway
pme03010  Ribosome
Module
pme_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:pme00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    NATL1_19871 (rpsE)
Ribosome [BR:pme03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    NATL1_19871 (rpsE)
  Bacteria
    NATL1_19871 (rpsE)
  Archaea
    NATL1_19871 (rpsE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S5_C Ribosomal_S5
Motif
Other DBs
NCBI-ProteinID: ABM76543
CyanoBase: NATL1_19871
CYORF: NATL1_19871
UniProt: A2C4Y3
Position
complement(1639342..1639968)
Genome map
AA seq 208 aa AA seqDB search
MTDSNNQSPNKKTSGSSGAPTAADGRQENRRSRGEKRGGRRDRRGQERDSEWQERVVQIR
RVSKTVKGGKKMSFRAIVVVGNEKGQVGVGVGKAGDVIGAVRKGVADGKKHLVRVPLTRN
SSIPTLSNGRDGAASVLIRPAAPGTGVIAGGSIRTVLELAGIKNVLAKRLGSKTPLNNAR
AAMVALSELRTHKATAKERGISLEQIYS
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgacagactctaacaaccagtccccaaataaaaaaacttctggatcatcaggtgctcct
acagcggcagatggtaggcaggaaaatcgtcgcagtcgtggtgaaaaacgcggaggaaga
agagatcgaagaggtcaagaaagagattctgagtggcaagaaagagttgtccaaattaga
agggtttcgaaaacagtcaaaggtggaaaaaaaatgagttttagagcaatagttgtagta
ggcaatgaaaaaggacaagttggagttggtgtaggaaaagccggagatgttattggtgcc
gttcgtaaaggagttgctgatggcaaaaaacatttagttcgtgttcctttaactcgaaat
agttcgatcccaactctctctaacggtagagatggggcagcaagtgtgttgattcgtccc
gcagctcctggaacaggcgtaattgctgggggttcaattcgtactgttttagagttggct
ggaattaagaatgtacttgcaaagcgcttaggcagtaagacccctcttaataatgctcgt
gctgcaatggttgctttaagtgagttaagaactcataaagccacagcaaaagagcgtggt
atttcacttgagcagatttattcctaa

DBGET integrated database retrieval system