KEGG   Prochlorococcus marinus NATL1A: NATL1_20711Help
Entry
NATL1_20711       CDS       T00467                                 

Definition
two-component response regulator (EC:3.1.1.61)
Orthology
K05971  
[EC:3.1.1.61]
Organism
pme  Prochlorococcus marinus NATL1A
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1715525..1716265)
Genome map
AA seq 246 aa AA seqDB search
MTCILVVDDEPAVLKVLVTRLNLAGYQVLSAQDGEQALEVFHKEAPDLVVLDVMLPKMDG
FAVCRRIRAESCVPIIFLTALEAISERVAGLDLGADDYLAKPFSPKELEARIATILRRVG
PAPTIDEPREVPSGQGVMKLGDLVVDTNRRQVSRGGERIGLTYTEFSLLELLFRDPGRVV
PRAEILEQLWGYPPRRAADLRVVDVYVARLRGKLEPDPRNPELILTVRGIGYASQRIGEF
PTAIAS
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgacctgcattttggttgtagatgatgaaccagcagtattgaaagtcttggtaacgagg
ctaaatcttgctggttatcaagttttatctgcacaggatggagagcaagcactagaggtt
tttcacaaagaagctccagacttagtggttctagatgtcatgctccctaagatggatggc
tttgcagtttgtcgaagaattagagctgagtcttgcgttccaataatattcttgactgct
cttgaagcgatttcagaaagagtagcaggtttggatttaggcgctgatgattacctggct
aaaccatttagccccaaggagttagaagctagaatagcgacgattttgagacgagtggga
cctgctccaactattgatgaaccaagagaagtcccgtcaggtcaaggagtaatgaagctt
ggtgatcttgttgtagacaccaatagaaggcaagtcagtagaggaggagaaaggataggc
ttaacatatacagaatttagcttgctggaattattatttcgtgatcctggccgtgttgta
cctcgagcagaaattctggaacagctttggggttatcctccaagaagagcggcggattta
agagttgtagatgtctacgtagctcgtttaagagggaagcttgaaccagatcctaggaat
cctgagttgattttgactgtcagaggtattggctacgcttctcaaagaattggagaattt
cctactgctattgccagttaa

DBGET integrated database retrieval system