KEGG   Prochlorococcus marinus NATL1A: NATL1_20761Help
Entry
NATL1_20761       CDS       T00467                                 

Gene name
dedA
Definition
DedA family alkaline phosphatase-like protein (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
pme  Prochlorococcus marinus NATL1A
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pme00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:pme00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:pme02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1719229..1719885)
Genome map
AA seq 218 aa AA seqDB search
MEISEFISSLPVFIGNAVETNQWIGYGAILLAMFLENLIPPIPSELIMPLGGFYVSQGQL
DFLPVVLAGLIGTVIGALPWYGIGRLVNEERLEKWLEKNGRWIGIKPQELARSRKWFNRY
GVSLVFWGRLVPGIRTLISVPAGVELMPITPFLIWTTAGSLIWTLFLTITGFYLGDNYAN
IETFISPFSSIFKTIIILTISAALITLIYKTLRKIINN
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggaaatatctgaatttatttcttctttaccagtatttataggaaatgcagttgagacc
aatcagtggattggttatggagcgatcttattggcaatgtttttggaaaacctaattccg
ccaattccttcggagttgattatgcctcttggaggcttttatgtgtctcaaggtcaatta
gattttttaccagttgttttagcaggtttaatcggaactgttattggggcgttgccttgg
tatggaattggcagattggtgaatgaagaaagacttgagaaatggcttgagaagaatgga
cgttggattgggattaagcctcaggaacttgctcgcagtcgtaaatggttcaacaggtat
ggagtgtctttagtcttctggggaagattagtacctggaattcgtactttgatttcagtt
ccagcaggggttgagttaatgcctatcactccttttctaatttggacaaccgcaggaagc
ttgatttggacgttgtttttaacaattacagggttctatttaggggataattatgcaaat
attgaaacgtttattagtcctttctcaagtatatttaagacaatcatcatcttaactatt
tctgcagctttgataactttaatttataaaactctacgtaaaataattaacaactaa

DBGET integrated database retrieval system