KEGG   Prochlorococcus marinus NATL1A: NATL1_21591Help
Entry
NATL1_21591       CDS       T00467                                 

Gene name
speB
Definition
arginase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
pme  Prochlorococcus marinus NATL1A
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pme00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1815834..1816733
Genome map
AA seq 299 aa AA seqDB search
MTKSNLKDLSLFNNDGGIFLGAQRGIDQCRVSLLGVPYDGTCCFRPGARFGPSAVREDSY
GIETYCPQLNLDLEDIKFADIGSLDVPLGDAKLTLDYIKDATNILLKNNLKPLIIGGEHS
ITSGIIKSIITKYPDLIMLQLDAHADLRDEWLGSKFSHACTMKRCLEILPSKKIFQIGIR
SGTKSEFLEMNNSKRLIQHTLGENAKSLEEALKSFKGRPIYLTFDLDWFDPSVMPGTGTP
EPGGYFWGDFAAIINVIKSHNLIGADVVELSPKLDNTGISSILAAKVVRSLILLLDKSS
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaatccaacctcaaagatctatcactatttaataacgatggtggaatatttttg
ggcgcccaaagaggcatcgatcaatgcagagtgtcacttttaggagttccttatgatgga
acttgttgctttagacctggtgcaagatttggaccttctgctgttagggaagatagttat
ggaattgaaacatattgtccgcaattaaatttagatttagaagatataaaatttgctgat
ataggttcattagatgttccccttggagatgcaaaattaacacttgattatataaaagat
gctacaaatattttacttaaaaataatttaaagcctcttattattggtggtgagcattca
ataacaagtgggattattaaatcaataattactaagtatcctgacttgattatgcttcaa
ttagatgctcatgcagaccttagagatgaatggttaggtagtaaatttagtcatgcatgt
actatgaaaagatgtttagaaatactacctagcaaaaagatttttcaaataggaataaga
agtggaacaaaatcagaatttcttgaaatgaataatagtaaaaggttaattcaacatact
ttaggggagaatgcaaaatctttagaagaagctctaaaaagttttaaaggtagaccaatc
tatttaacttttgatttagattggtttgatccctctgtaatgccaggaacaggcactcct
gagcccggaggctatttttggggagattttgcagcaataataaatgtgattaagtctcat
aatttaattggtgctgatgtagtcgaattatctcctaaattagataacactggtattagt
agcatccttgctgcaaaagttgtacgttcattaattctgttgttggacaaatcatcctaa

DBGET integrated database retrieval system