KEGG   Prochlorococcus marinus NATL1A: NATL1_22001Help
Entry
NATL1_22001       CDS       T00467                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pme  Prochlorococcus marinus NATL1A
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NATL1_22001 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NATL1_22001 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    NATL1_22001 (thrC)
Enzymes [BR:pme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     NATL1_22001 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1863437..1864543
Genome map
AA seq 368 aa AA seqDB search
MSFSKKLKQLFTSTPPKNNWDGLIETYKTWLPVSNKTPIITLKEGATPLIEVNSISNRIG
NGVKVFVKYDGLNPTGSFKDRGMTMAISKAKEAGCEAVICASTGNTSASAAAYASKGGMK
SFVIIPDGYVAQGKLAQALVYGAEVLAIKGNFDKALDIVRELSNKYPITLVNSVNPYRLQ
GQKTAAFEIIENLGNAPDWLCIPMGNAGNISAYWMGFQEFFHAGKSKHLPRMMGFQASGS
APLVEGKSISNPETIATAIRIGNPVNREKALLAKESSNGRFSSVSDSEIINAYKILGREE
GIFCEPASAASVAGLLKIKEDVPKNSTIVCVLTGNGLKDPDCAIKNNDSMFHTGVEPEIS
SITKIMGF
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
gtgtcattttctaagaaattaaaacaacttttcacttctaccccacccaaaaacaattgg
gatggacttatagaaacatacaaaacctggttaccagtaagtaataagacacccatcatt
actttaaaagaaggcgcaactcctcttattgaagtcaattccatttctaatcgaattgga
aatggagtaaaagtatttgtcaaatatgacggtctaaatccgactggatccttcaaagac
agaggaatgactatggcgataagtaaagctaaagaagctgggtgtgaagctgtaatttgc
gcaagcacaggtaatacttcagcctctgcagcagcttatgcaagcaaaggaggaatgaaa
tcctttgttattattccagatggatatgtagctcaaggtaaactagctcaagctttagtt
tacggagctgaagtattagctattaaagggaattttgataaagcactagatattgttaga
gaactatctaataaatatccaattactttagtgaactcggtaaatccttacagattacaa
ggacaaaaaaccgcagcatttgagataatagaaaatcttggaaatgcacctgattggtta
tgcattccaatgggaaatgctggaaatataagtgcttactggatgggatttcaagaattt
tttcacgctggaaaatcaaaacatctcccaagaatgatgggttttcaagcgagtggttct
gcgcctttagtcgaaggtaaaagtatcagtaaccctgagacaattgctacagcaataaga
attggtaatcccgttaatagagaaaaagctcttttagcaaaagaatcaagcaatggtaga
ttttcttctgtatcagattcagaaataatcaacgcatataaaattcttggtagagaagaa
ggcattttttgtgagcctgcaagtgcagcttctgtggctggtttattaaaaatcaaagaa
gatgtcccaaaaaattcaactattgtttgtgttttgacagggaatggtctaaaagatcct
gattgcgcaataaaaaataatgactcaatgtttcatacgggagttgaaccagaaataagt
tcaataacaaaaataatgggcttttaa

DBGET integrated database retrieval system