KEGG   Prochlorococcus marinus MIT 9303: P9303_00271Help
Entry
P9303_00271       CDS       T00466                                 

Gene name
gap2
Definition
(RefSeq) glyceraldehyde 3-phosphate dehydrogenase (EC:1.2.1.12 1.2.1.13)
  KO
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
pmf  Prochlorococcus marinus MIT 9303
Pathway
Glycolysis / Gluconeogenesis
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:pmf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    P9303_00271 (gap2)
   01230 Biosynthesis of amino acids
    P9303_00271 (gap2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    P9303_00271 (gap2)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    P9303_00271 (gap2)
Enzymes [BR:pmf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     P9303_00271 (gap2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
30825..31955
Genome map
AA seq 376 aa AA seqDB search
MTLCQVWAASSSGTAESATYFCMIGGHFPCGFPVFVMTLRVAINGFGRIGRNFMRCWLSR
GVNTGIEVVGVNVTSDPKTNAHLLKYDSILGQIKDAEIDYTDDTFVINGKPIKCFSDRNP
LNLPWKEWGIDLVIESTGVFNTDVGASKHIEAGAKKVILTAPGKGDGVGTYVVGVNADQY
RHGDFNVLSNASCTTNCLAPIVKVLDQNFGMEWGLMTTIHSYTGDQRILDNSHRDLRRAR
AAALNMVPTTTGAAQAVALVYPEVKGKLTGFAMRVPTPNVSAVDLTFGTSKGPSVDDVKA
VMKSASENGMKGIIKYSDLPLVSTDYAGTNESSIFDADLTYAMGDKAVKILAWYDNEWGY
SQRVVDLAEIVAKNWK
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
ttgaccttgtgccaggtatgggccgcctcctcatccggaacagcggaaagtgcaacctat
ttctgtatgatcggcggccacttcccttgcggtttccccgtttttgttatgactctgcgc
gttgcgatcaatggattcggccgaatcggtcgcaacttcatgcgttgttggctaagccgt
ggcgtgaatactgggattgaagtggttggcgtcaacgtcacttctgaccctaagaccaat
gctcatctgctcaagtacgattcaattcttggacagatcaaggatgcggagatcgattat
accgatgacacttttgttatcaatggcaaaccaattaagtgtttttcagatcgcaacccc
ttgaatcttccttggaaggagtggggtatcgatcttgtgatcgagtccaccggggttttc
aatactgatgtcggggctagtaaacacatcgaggctggtgcgaagaaagtgatcctcaca
gctccaggtaaaggagatggtgtgggcacatatgtcgtaggcgtcaatgctgatcagtac
cgtcacggtgatttcaatgttctcagtaatgccagctgcaccaccaattgcttggctcca
attgtcaaagttttagatcagaatttcggaatggaatggggtttgatgaccaccattcac
agctataccggtgaccagagaattcttgacaacagccaccgtgatctacgccgcgctcga
gcagcagcgttgaatatggttccaaccactaccggtgctgcacaggctgttgcgttggtt
tatcccgaagttaaaggcaagctcaccggtttcgcgatgcgggttccgactccaaatgtg
tcagctgttgacctgactttcggaacttcaaaaggcccaagcgttgatgatgtgaaagcc
gtgatgaagagtgcttctgagaacgggatgaagggaatcatcaagtacagcgatttgcct
ctcgtctcgaccgactacgccggaacgaacgagtcgtccatctttgatgctgatctcact
tatgccatgggtgataaggccgtgaaaattctggcttggtatgacaacgagtggggttat
agccagagggttgtcgatctcgctgagattgtggccaagaattggaagtga

DBGET integrated database retrieval system