KEGG   Prochlorococcus marinus MIT 9303: P9303_00941Help
Entry
P9303_00941       CDS       T00466                                 

Gene name
rfbC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
pmf  Prochlorococcus marinus MIT 9303
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmf00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    P9303_00941 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    P9303_00941 (rfbC)
Enzymes [BR:pmf01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     P9303_00941 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
94031..94636
Genome map
AA seq 201 aa AA seqDB search
MQAEVLTSAAGIHLNGPLLLSPQVHGDERGFFFESWNQRRWQEVLASHRQEAPEFVQDNH
SRSSCGVLRGLHYQLPPHPQGKLVRCVVGEIFDVAIDLRRSSATYGQWAGAHLSAENHQQ
LWIPVGFAHGFLTLSESAEVLYKATDFWSRDCERAIRWDDPRLGISWPVVHVDGDQIPAS
LSQKDAVASLMEELSAAETFK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaagctgaagtcctgacctccgcggcagggatccatctaaacggacctttgttgttg
tctcctcaggtgcatggcgatgaaagaggatttttctttgagagttggaatcagcgtcgt
tggcaggaggttttggcaagtcataggcaggaagcgcctgagtttgtccaagacaatcac
tcgcgttcgtcttgtggcgtgctgcgtggactgcactatcaattgcccccgcatccccag
ggcaagctggtgcgttgcgtagtaggtgagatctttgatgttgctattgatctgcgccgt
tcttcagcaacctatggtcagtgggccggagctcatttgagtgctgagaaccatcagcag
ctttggataccggttggctttgcccatggttttctgactctctcagagagtgctgaggtg
ctttataaagccacggatttctggagtcgcgattgtgaacgggcgatccgctgggatgat
ccacgcctaggaatttcctggcctgttgttcacgtggatggagatcagattccagcatct
ctttctcagaaggatgctgttgcttctttgatggaggagttgtctgcagctgaaaccttc
aaatga

DBGET integrated database retrieval system