KEGG   Prochlorococcus marinus MIT 9303: P9303_01621Help
Entry
P9303_01621       CDS       T00466                                 

Gene name
btuE
Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pmf  Prochlorococcus marinus MIT 9303
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pmf00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    P9303_01621 (btuE)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    P9303_01621 (btuE)
Enzymes [BR:pmf01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     P9303_01621 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(179466..179945)
Genome map
AA seq 159 aa AA seqDB search
MAINISQIVVRTPEGAEKSLSEYNGTVLLIVNVASRCGFTKQYKGLQALQDTYGPKGLKV
LGFPCNDFGAQEPGTLEEIKSFCSTTYGASFELFDKVHAMDKTTEPYTTLNQTEPAGDVA
WNFEKFLVGKDGTVIKRFKSGVEPESTELKGAIEQALNT
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atggccatcaacatcagccagattgtggttcgcactccagaaggtgctgagaaatccctc
agcgaatacaacggcacggtgctgttaatcgtgaatgtggccagccgatgtggatttacc
aagcaatacaaaggcctgcaagcgctgcaagacacatacggccctaagggactaaaggtg
ctgggctttccttgcaacgacttcggagcccaggagcccggcaccctcgaagagatcaaa
agcttctgttccacgacctacggcgccagcttcgagttgtttgacaaggtgcacgccatg
gacaaaaccaccgagccttacaccaccctcaatcaaactgaaccagcaggggatgtggct
tggaacttcgaaaagtttcttgtgggtaaggacggcaccgtgatcaaacgtttcaagagc
ggcgtggagcctgaaagcactgaactgaaaggtgcgatcgagcaagcgttgaacacctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system