KEGG   Prochlorococcus marinus MIT 9303: P9303_01831Help
Entry
P9303_01831       CDS       T00466                                 

Definition
two-component response regulator (EC:3.1.1.61)
Orthology
K05971  
[EC:3.1.1.61]
Organism
pmf  Prochlorococcus marinus MIT 9303
Brite
Enzymes [BR:pmf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     P9303_01831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
202013..202885
Genome map
AA seq 290 aa AA seqDB search
MSHPGGSSQFQSNAGSETQAPGNPKATILVVDDEPAVLRILVMRLQLAGYRVICAEDGEE
ALEIFHREQPDLLVLDVMLPRLDGFAVCRRLRAESCVPIIFLSALEAISERVAGLDLGAD
DYIPKPFSPKELEARIATILRRVGPGSATAEIRDLPVGQGVMRVGDLVVDTNRRQVSRAG
ERIGLTYTEFSLLELLFREPGRVVPRAEILEQLWGYPPRRAADLRVVDVYVARLRGKLEP
DPRNPELILTVRGIGYSSQRVGDIPASASASASASAPASAPASASVAVAS
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgtcacatccggggggttcatctcagttccaaagcaatgctgggtctgagacgcaggct
cccgggaatccgaaggcaaccatccttgtcgttgacgatgagccagcagtcctccggatt
ttggtcatgcgacttcaactggctggctatcgggtgatttgtgccgaggacggggaagag
gcccttgagatttttcatcgagaacagcctgacttgcttgtgctcgatgtgatgctgccc
aggctcgatggttttgctgtttgtagaaggcttagggctgagtcttgtgtgccgattatt
ttcctctcagcattagaggcgatttctgaacgtgtggctggacttgatcttggggcagat
gattacattcctaagccctttagtcccaaggaacttgaggctcgtattgccacaattctg
cgtcgggttggtccagggtccgctacggctgaaatcagagatctgccagttgggcagggt
gttatgcgagttggtgatttggtggttgacaccaatcgccgccaggtgagtcgtgcagga
gagcgtattggcctcacctacaccgaattcagtcttttggaactgttgttccgtgaacct
ggacgggtggtacccagggccgaaatcttggagcagctctggggttatccccctcgccgt
gcggccgacttgcgtgtggtcgatgtttatgtagctcgtttgcgtggcaagctcgagcca
gacccgcgcaatccagagctaatccttacggttcgtggaattggttactcctcccagcgc
gttggggatattcctgcttctgcttctgcttctgcttctgcttctgctcctgcttctgct
cctgcttctgcttcggttgccgttgcgagttga

DBGET integrated database retrieval system