KEGG   Prochlorococcus marinus MIT 9303: P9303_01831Help
Entry
P9303_01831       CDS       T00466                                 

Definition
(GenBank) two-component response regulator (EC:3.1.1.61)
Organism
pmf  Prochlorococcus marinus MIT 9303
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
202013..202885
Genome map
AA seq 290 aa AA seqDB search
MSHPGGSSQFQSNAGSETQAPGNPKATILVVDDEPAVLRILVMRLQLAGYRVICAEDGEE
ALEIFHREQPDLLVLDVMLPRLDGFAVCRRLRAESCVPIIFLSALEAISERVAGLDLGAD
DYIPKPFSPKELEARIATILRRVGPGSATAEIRDLPVGQGVMRVGDLVVDTNRRQVSRAG
ERIGLTYTEFSLLELLFREPGRVVPRAEILEQLWGYPPRRAADLRVVDVYVARLRGKLEP
DPRNPELILTVRGIGYSSQRVGDIPASASASASASAPASAPASASVAVAS
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgtcacatccggggggttcatctcagttccaaagcaatgctgggtctgagacgcaggct
cccgggaatccgaaggcaaccatccttgtcgttgacgatgagccagcagtcctccggatt
ttggtcatgcgacttcaactggctggctatcgggtgatttgtgccgaggacggggaagag
gcccttgagatttttcatcgagaacagcctgacttgcttgtgctcgatgtgatgctgccc
aggctcgatggttttgctgtttgtagaaggcttagggctgagtcttgtgtgccgattatt
ttcctctcagcattagaggcgatttctgaacgtgtggctggacttgatcttggggcagat
gattacattcctaagccctttagtcccaaggaacttgaggctcgtattgccacaattctg
cgtcgggttggtccagggtccgctacggctgaaatcagagatctgccagttgggcagggt
gttatgcgagttggtgatttggtggttgacaccaatcgccgccaggtgagtcgtgcagga
gagcgtattggcctcacctacaccgaattcagtcttttggaactgttgttccgtgaacct
ggacgggtggtacccagggccgaaatcttggagcagctctggggttatccccctcgccgt
gcggccgacttgcgtgtggtcgatgtttatgtagctcgtttgcgtggcaagctcgagcca
gacccgcgcaatccagagctaatccttacggttcgtggaattggttactcctcccagcgc
gttggggatattcctgcttctgcttctgcttctgcttctgcttctgctcctgcttctgct
cctgcttctgcttcggttgccgttgcgagttga

DBGET integrated database retrieval system