KEGG   Prochlorococcus marinus MIT 9303: P9303_06011Help
Entry
P9303_06011       CDS       T00466                                 

Gene name
cysQ
Definition
CysQ (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
pmf  Prochlorococcus marinus MIT 9303
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:pmf00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
567322..568326
Genome map
AA seq 334 aa AA seqDB search
MTNGRPNHIEHPWCWFLSLAQNEACTCLFMMPNAPLLPVGVDLEVLLQQLRRLSWGAADI
LLAYARGEQPPHGFSKALSVDDGGEGPVSAADLAVNRWLLDGLEANFPLADWTLLSEETA
KEQLTEGEPLAAEWLWILDPLDGTKDFLQGTGEYAVHLALVHGQRPVLGVVLLPEAEELW
FGVIGSGAWCEDRQGQRSPVRFSQRKAFGELMLVASRNHRDNRLEQLLESLALGGSKAVG
SVGCKVTTILRGETDLYVSLSGRSAPKDWDMAAPEAVLMAAGGCFTHADGRQLAYNSGDV
RQAGCLIASHGLAHAQLCEAAARAMEEIDPGFQV
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaatgggcgtcccaaccacatagagcacccctggtgctggttcctctcgctggct
caaaatgaggcttgcacgtgtctattcatgatgccgaatgcacctcttctccctgttggt
gtggacctggaggttttgttgcagcaattgaggcgattgagctggggtgctgcagacatc
ctgctggcctatgcccggggagaacagccaccgcatggattttctaaggctctgagtgtt
gacgatggtggtgaggggcctgtctctgccgctgaccttgcggtgaaccgttggcttctg
gatggcttagaagcgaatttccccttggcagattggactctattgagtgaggagacggca
aaggagcaactcactgaaggcgaacccttagcggcggaatggttgtggatccttgacccc
ttggatggcacaaaggacttcttgcagggcacaggtgaatacgccgtgcatcttgccttg
gtgcatggtcaacgaccagtgcttggcgtggtactcctgccagaagccgaggagctttgg
ttcggtgtgatcggttctggtgcctggtgcgaagaccggcagggacaacgttcgccggtg
cgttttagtcagcgcaaggcttttggtgagttgatgctggtagcgagtcgcaaccaccgc
gacaacaggcttgaacagctgctagagagtcttgctcttggtggtagcaaggctgtgggc
agtgttggttgcaaggtaaccacgattctgcgcggagaaacagatctgtatgtctctctt
tcaggccgtagtgctccaaaagactgggatatggctgctccagaggcggtgctgatggct
gcagggggatgtttcactcatgctgatggacgccagcttgcttacaacagcggtgatgtg
cgtcaggccggatgtttgatcgccagccatggcctcgcccacgcccagctttgtgaagca
gcggcgcgggctatggaagagatcgacccaggctttcaggtttga

DBGET integrated database retrieval system