KEGG   Prochlorococcus marinus MIT 9303: P9303_07841Help
Entry
P9303_07841       CDS       T00466                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pmf  Prochlorococcus marinus MIT 9303
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pmf00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
719615..720388
Genome map
AA seq 257 aa AA seqDB search
MTSIIPASSKDLGQHRNRNGLPGNGQPKNENKISERIRARLVAEDVSFLANDNIAEHIQP
GELKELEVEVADRVRELLQSLVIDIDNDHNTQETAERVARMYLNEVFKGRFYEQPDVTSF
PNTKDLDEIYTVGPITVRSACSHHLVPILGNCWIGIKPGSRVIGLSKFARVADWVFSRPH
IQEEAVMILADEIERLCEPKGLGIIVKAQHYCMKWRGVKEPNTSMVNSVVRGVFRHDPSL
KQEFFELVRQQESTLGA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgacttccataatcccagcatcatctaaagacctaggtcagcatcgcaatcgcaatggc
ttgcctgggaatggtcagccaaaaaatgaaaataagatctctgaacgtatacgtgcccgc
cttgttgcagaagatgtttccttcctcgccaacgacaatattgcagaacacattcaacct
ggagagctgaaggaacttgaagtagaagttgccgatcgcgtgcgagaactgctccaaagc
ctagtgattgatattgataatgaccacaacacacaagagactgccgagcgggttgctcgc
atgtatttaaatgaagtatttaaaggtcgattctatgagcagccagatgttactagcttt
ccaaatacaaaagatttagatgaaatttatactgttggccccataactgttcgttctgct
tgctctcatcatttggttcctatccttggtaactgttggattggcattaagcctggcagc
cgtgtaattgggctctcaaagtttgcgagagtggctgactgggtcttttcaaggccacat
atccaggaagaagctgtaatgattcttgctgatgaaatagagcgtttatgtgagcctaag
ggtttagggataatagtaaaagcacaacattattgtatgaaatggcgaggagtgaaagag
ccaaataccagcatggtgaactcagttgtcagaggagtttttcgtcatgaccctagcctt
aagcaggaatttttcgagcttgttcgccagcaggagtccacgctaggagcttaa

DBGET integrated database retrieval system