KEGG   Prochlorococcus marinus MIT 9303: P9303_09631Help
Entry
P9303_09631       CDS       T00466                                 

Gene name
recD
Definition
(GenBank) possible exodeoxyribonuclease V 67 kD polypeptide
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
pmf  Prochlorococcus marinus MIT 9303
Pathway
pmf03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:pmf00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    P9303_09631 (recD)
Enzymes [BR:pmf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     P9303_09631 (recD)
DNA repair and recombination proteins [BR:pmf03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     P9303_09631 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 AAA_11 Helicase_RecD UvrD-helicase Viral_helicase1 PhoH UvrD_C AAA_22 PIF1 DUF2075 AAA_16 T2SSE AAA AAA_25 UBA AAA_28 DEAD ATPase
Motif
Other DBs
NCBI-ProteinID: ABM77714
CYORF: P9303_09631
UniProt: A2C8A4
Position
874875..876605
Genome map
AA seq 576 aa AA seqDB search
MTRSDSSTWPSGFPRALHQTLLRRLPPKASSVHLEDLVNALMDALARGELQLNLTAMSPP
QELKAMGWPEAHCQALLASGWLEGAASPMVLNGNQLSWRRWHGDMDAVIKELINRSNVVQ
ATSICTTPSHHPALLDGLNPEQQAAVEAIDNHGVVLLSGGPGTGKTSTIVQMLARAVTLR
PGLRIGLAAPTGKAARRLEEAVRKGLEAIPPTQRQALTSLPCSTLHRWLQARPGGFGRHQ
QHPLMLDLLVIDEMSMVELSLMQALLSALPIDSQLVMIGDPDQLPPVGSGAVWHQLQQAD
IRQQFNHGAIHLHQLYRNRGSLATLSRVLCDQGLSAFWQQLSLLPKSANVEQHQCNLSSM
PRFLVQHLQEHSRTLQRLTAELMLELPDDAYTSTMLNTNLAVAAESLLDSLERLMVLCPK
RRGFWGVDDVHRALLGQSLEAGVMRWPLGTPVMCCENQAELGLANGDVGLVVGQGDNLRI
LFRVISEQGGLTTRFIHPARLSVVEPALALTVHKSQGSEADHVILLWPEIKAVSATSADG
FESASSFERKLLYTAITRARQRVDLVTAMASGRSDG
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgactcgcagcgattcatccacttggccatcaggttttcccagagcactgcatcaaacg
ttgttgaggcgtctcccgccgaaggcttcatcagttcatctcgaggacttggtcaacgcc
ttgatggatgcattagcccgcggtgagctgcagctgaatctcactgcgatgtctccccct
caagaactcaaagcgatgggatggcctgaggctcattgtcaggccctgctggctagtggc
tggctggaaggcgcggcttctccgatggttttaaacggtaatcaattgagttggcgtcgt
tggcatggtgatatggacgctgtgatcaaggagttgatcaacaggtcaaatgttgttcaa
gcgacttcaatctgcaccacaccatcccatcatcctgctttgctggatgggcttaaccct
gaacagcaggctgccgtagaagccatcgataaccatggcgtggtgttgttgagtggcggt
ccgggtacgggcaaaaccagcaccatcgtgcaaatgttggcgcgggcagtcacgttgaga
ccaggcctgaggattggtcttgctgctcccacaggcaaagcggcaagacgcctagaggag
gctgttcgcaaggggctggaggcaatccctcccacccagcggcaggcattgaccagcctg
ccttgtagcaccctccaccgctggcttcaggctaggcctggtgggtttggtaggcatcaa
caacaccccctaatgcttgatctcctcgttattgatgagatgtcgatggtggagctttcc
ctgatgcaggcgttattaagcgccctgcctattgatagtcagcttgtgatgattggtgac
ccggatcagttgcctccagttggtagtggagcggtttggcatcaactccaacaggctgat
atccgccaacagttcaatcatggtgccattcacctgcatcagctctatcgcaaccgcggt
tcactagcgacgttgagcagagttctgtgtgatcagggcctttctgctttttggcaacaa
ctttctcttctgccgaaatcagcgaacgttgagcagcatcaatgcaacctcagcagcatg
ccaaggtttttagttcagcacttgcaggagcacagcagaacactgcaacgactcactgcc
gaactgatgctcgagctgccagatgatgcttatacgtcaaccatgctcaacaccaatctt
gccgttgcagctgagtctctgctggattctctcgagcggttgatggtgctttgtccgaaa
cgtcgtggtttttggggagttgatgatgtgcatcgagcattgttgggtcaaagccttgag
gctggagtgatgcgctggccgttgggaacgccggtgatgtgttgcgagaaccaagcggaa
ctggggctagcaaacggtgacgttggcttggtggttggtcaaggagacaatctgcgcatc
ctgtttcgcgtgatctctgagcagggaggactgaccacacgcttcatccacccggcccga
ttgagcgtggtggagccagctttggctcttacggttcataagtctcaggggagtgaggct
gatcatgtcattcttctctggccggaaataaaagctgtgtcggctaccagtgctgatggt
tttgagagcgcttctagcttcgagaggaaacttctctacactgctatcacgcgcgcgcga
cagcgagtggatctcgttactgcaatggcatctggtcgtagtgacggctga

DBGET integrated database retrieval system