KEGG   Prochlorococcus marinus MIT 9303: P9303_09731Help
Entry
P9303_09731       CDS       T00466                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
pmf  Prochlorococcus marinus MIT 9303
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pmf00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    P9303_09731 (recR)
DNA repair and recombination proteins [BR:pmf03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      P9303_09731 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
884374..884943
Genome map
AA seq 189 aa AA seqDB search
MIDQFERLPGIGPRTAQRLALHLLRQPEDQIRAFAEALLAARSQVGQCQTCFHLSAEPLC
DICRDGTRCDQLLCVVADSRDLLALERTREYKGRYHVLGGLISPMDGIGPDMLQIPSLIQ
RVDRDGISEVILALTPSVEGDTTSLYLARLLKPFTQVSRIAYGLPVGSELEYADEVTLTR
ALEGRRAMQ
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgaccagttcgagcgtctgcctgggattgggccacgaacggcccagagacttgcc
ctgcatctgttgagacaaccggaagatcaaatccgcgcttttgctgaggcactcctcgcg
gcccgttctcaagtgggtcaatgtcagacctgttttcatctcagcgcggagcctttatgc
gacatttgccgtgatggcacgcgatgcgatcaattgctttgtgtggtggctgattcccga
gatctgctagctctcgaaagaaccagggaatataagggtcgctatcacgtcctcggtgga
ttgatttcaccaatggatggtatcgggccggacatgctgcagatccccagcttgattcaa
cgcgttgatcgagatggcatcagcgaggtcattctcgctctcactcccagtgttgaaggt
gacaccactagtctttacctggcacgcttgttaaagccgttcacccaagtgagtcgaatc
gcctacggccttcctgttggtagtgagttggagtatgccgacgaagtcaccctgactcgt
gcacttgaaggccgtcgagctatgcaataa

DBGET integrated database retrieval system