KEGG   Prochlorococcus marinus MIT 9303: P9303_09791Help
Entry
P9303_09791       CDS       T00466                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pmf  Prochlorococcus marinus MIT 9303
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmf00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    P9303_09791 (malQ)
Enzymes [BR:pmf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     P9303_09791 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
890079..891644
Genome map
AA seq 521 aa AA seqDB search
MVEGSSALVRTTGVLLHPTALPASPVCGSFGAPSRAWLQSLARHDIGVWQLLPLAPPDAT
GSPYSSPSSFALNPWLLDADDLVDEDFLSASVLRELPGTVPIQEPCASVDFALADLRSQR
LGIALREAWSEQARDHHLAFESWCGKQFWLEDHVLFMELRRQHQGLPWWEWPEGLAAHQR
RALNAWKGHHQEALLEHRLLQWQLDRQWQALRHLAGELGVLLFGDLPFYVARDSADVWSH
QGLFSILQGGELEIQSGVPPDYFSSTGQLWGTPVYRWWRHRWSGFHWWRSRFVRQWQQVD
LLRLDHFRALASYWAVPGSDTTAEHGEWRPSPGAALLKRLRRDAGGILPLVAEDLGVITP
DVEELRDQFGLPGMKILQFAFDGNPSNPYLPENIKGHHWVVYTGTHDNPTTLGWWQQLDL
DIRERVVDRLKGVVHAPGWQLLELGLATEACLVITPVQDLLHLDDVARFNTPGTVEGNWC
WRLSCFDSALDGALSGYGERGAVWGRSLESAAALLTASSSR
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggttgagggcagctcagcattagtccgcacgaccggggtgttacttcatcccacagca
ctgcctgcaagtccagtttgcggcagtttcggtgctccttccagggcttggttgcaatca
cttgctcgccatgacatcggcgtgtggcagttgttgcctttggctcctcctgatgcgaca
gggtctccctacagctccccttcaagctttgctcttaacccttggttgcttgatgccgat
gatcttgttgatgaggatttcctgtccgcatccgttcttcgtgagttgccaggaacagtc
cctatccaggagccttgcgcatcggttgattttgctctggctgaccttcgcagtcagcga
cttggcatagccttaagggaggcttggtcagagcaggctagagaccatcatcttgccttt
gagagttggtgtggcaagcagttctggcttgaggaccatgttttatttatggagctccgt
cgtcagcatcaaggcctcccttggtgggaatggccggaaggcttggcagctcatcaacgt
agggctctcaatgcctggaaaggtcatcatcaggaggcactgcttgaacatcgtttgctg
caatggcagcttgatcggcagtggcaagcactgagacatctagcaggcgagcttggcgtt
ttgttgtttggtgatctgcctttctatgttgcgcgcgatagcgctgacgtctggagtcat
cagggcctgttttcgatccttcaaggaggggagcttgagatccaaagtggtgttccccct
gattatttctccagtacaggacaactctggggcacgcctgtttatcgctggtggcggcat
cgctggagtggattccattggtggcgtagccgctttgtgcgtcaatggcaacaggtggat
ctcttacgtctcgaccatttcagggcgcttgcgtcttattgggcagtgcctggatccgat
acgacagcggagcacggggagtggcggccttctccaggtgcagctctattgaagcggcta
aggcgtgatgctggtggcatcttgccactggttgcagaagatctgggagtgattacccct
gatgtggaagagctacgagaccaatttgggttgcctggaatgaaaattctccagtttgct
tttgatggcaatcccagtaatccctatctacctgaaaatattaagggtcatcactgggtg
gtttatacaggcactcacgacaatccaacgactctgggttggtggcagcagcttgatctc
gacatccgtgagcgggtcgtagatcgattgaagggtgtagttcatgcccctggttggcag
ttgctggagctgggcctagcgacagaggcgtgtttagtgataacccctgtgcaggatttg
cttcatttagatgatgtagctcgtttcaacacccctggcactgtcgagggaaattggtgt
tggcggttgtcttgctttgattcagctcttgatggagccctgagcggctatggcgagaga
ggagctgtctggggacgttcgcttgaatcggcagccgctttgctgacggcatcttcgagt
cggtaa

DBGET integrated database retrieval system