KEGG   Prochlorococcus marinus MIT 9303: P9303_12381Help
Entry
P9303_12381       CDS       T00466                                 

Definition
pfkB family carbohydrate kinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pmf  Prochlorococcus marinus MIT 9303
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pmf00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    P9303_12381
Enzymes [BR:pmf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     P9303_12381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1074757..1075608)
Genome map
AA seq 283 aa AA seqDB search
MNLLEPQDLPDLPKLKLAVVGHVEWVTFLSTDQLPQPGVISHADHSFEEPAGGGAVVAVQ
LARLVKQPVQFITALSRDSYGEKSFQRLQQLGLSLTVAWRDQPTRRAISLVDSHGERAIT
VIGERLQPRAKDALGWGALAGYDGVFVTAADAPALHHCRHAGVMAATPRVRLETLEQANI
QLDALIGSGLDPGEHVPDKALFPTPRLRIATEGALGGQLWPGGRYQAVSLKSPVVDAYGC
GDSFAAGVTAGLAAGWTDEQAISLGAHCGASCATHFGPYSSDE
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgaatctcttggaaccccaggatctgccagatcttcccaagctgaagttggccgttgtg
ggccacgttgaatgggtgaccttcctgtctacagatcaattaccccagcctggggtaatc
agccatgcagatcattcttttgaagagcccgctggcggtggagctgtcgtcgcggtgcaa
ttggctcggctcgttaaacaacccgttcaattcataacagctctaagtcgagattcatac
ggtgaaaagagttttcaaagactccagcagcttggcttaagcctgactgtggcttggcgt
gatcaacccactcgtcgggcgatcagccttgttgattctcatggggaacgggcaattaca
gtgattggcgagcgtttacaacccagagcaaaagatgcgctgggctggggagcccttgct
ggttacgacggtgtttttgtgaccgctgcagatgcccctgcactgcatcattgtcgtcat
gctggtgttatggcagctactcctcgcgttcgtctagagacacttgagcaggcgaatatt
cagcttgatgcgctgattggtagtggtcttgatccaggcgaacacgttccagataaagct
ctctttccaactccccggctgagaattgcaactgaaggagctttaggcggtcagctatgg
cctgggggacgctatcaggctgtttcactgaagtctccagtcgtggatgcctatggctgt
ggcgatagctttgccgctggggtaactgcaggtttggctgctggttggactgatgaacag
gcgatcagcctaggggctcactgcggtgcaagctgtgcaactcattttgggccttactcc
agtgatgagtga

DBGET integrated database retrieval system