KEGG   Prochlorococcus marinus MIT 9303: P9303_13911Help
Entry
P9303_13911       CDS       T00466                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pmf  Prochlorococcus marinus MIT 9303
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pmf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    P9303_13911 (tpiA)
   01230 Biosynthesis of amino acids
    P9303_13911 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    P9303_13911 (tpiA)
   00051 Fructose and mannose metabolism
    P9303_13911 (tpiA)
   00562 Inositol phosphate metabolism
    P9303_13911 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    P9303_13911 (tpiA)
Enzymes [BR:pmf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     P9303_13911 (tpiA)
Exosome [BR:pmf04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   P9303_13911 (tpiA)
  Exosomal proteins of bladder cancer cells
   P9303_13911 (tpiA)
  Exosomal proteins of melanoma cells
   P9303_13911 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1186940..1187671
Genome map
AA seq 243 aa AA seqDB search
MRKPVIAGNWKMHMTCAQAREYTAMFLPLIEATPNDRHVVIAPPFTAISSMAEAVGGTRL
ELSSQNVHWEDDGAYTAEVSPTMLLEHQVRYAIVGHSEPRKYFSESDEQINRRARSAQAH
GLIPIVCVGESDEQRERGEAERVIRRQVEQGLEDTDPDKLVVAYEPIWAIGTGKTCEASE
ANRICGLIRGWVGASELIIQYGGSVKPGNIDELMAMSDIDGVLVGGASLDPESFARIANY
QTS
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtaaacccgtgatcgctggcaactggaagatgcacatgacctgtgctcaggcacgg
gagtacacggccatgttcctgccattaatcgaagccactcccaatgaccgtcatgtagtg
attgccccaccattcaccgccatctcttcaatggcagaggccgttggcggcactcgtctg
gaattgtcaagccagaatgtgcattgggaggatgatggtgcctataccgcagaggtttcg
ccaacgatgcttctggagcatcaagtgcgatacgcgattgttggccatagtgaaccacgt
aaatacttcagtgagagcgatgaacagatcaatcgtcgtgctcgttcagcccaagcgcat
ggtctgatcccgattgtctgcgtgggtgaaagtgatgagcagcgtgaacgcggagaggct
gagcgtgtgattcgacgacaggtggaacagggactggaagacaccgatccagacaaactt
gtggttgcttatgagcccatctgggccattggcacgggcaagacgtgcgaagcctcggag
gcgaatcgtatctgtggcctcattcgtggttgggtcggtgcttcagaactaatcattcag
tacggcggttcggtcaaaccaggaaatatcgatgaactgatggcgatgagtgatatcgac
ggagtgttggtgggtggtgcttcccttgacccagagagttttgctcgcattgccaattat
caaaccagttaa

DBGET integrated database retrieval system