KEGG   Prochlorococcus marinus MIT 9303: P9303_16181Help
Entry
P9303_16181       CDS       T00466                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pmf  Prochlorococcus marinus MIT 9303
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:pmf00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1418555..1419514
Genome map
AA seq 319 aa AA seqDB search
MSISSPSAASGHLVSVSAPAKINLHLEVLGLRSDGFHELAMVMQSIELADQLHFRNTADG
TISLRCDDSSLSTAGDNLIVQAAHLLRERSGFSELGAAIELQKRIPIGAGLAGGSSDGAA
TLVGLNGLWNLNFSQGQLEGFAAELGSDMPFCLAGGSQLCFGRGERLESLQAMQASMAVV
LVKDPSVSVSTPWAYGRCKELFRSRYLSQESDFEQRRQQLRESSWLNPLRADDPPPLHND
LQAVVAPEVFAVQTTLKLLSDLPGSLAVAMSGSGPSCFALFADVDSAQAALKRQQPAFDA
AGLSSWCCAFRSEGIKLEA
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgagcatatctagcccttctgctgcttcagggcatctggttagcgtctcggcgccagcc
aagatcaatctccatcttgaggtgcttggcctcaggtctgatggttttcatgagctagcg
atggtgatgcaaagcatcgaactcgctgatcaacttcatttccgcaatacggctgatggc
accatcagcctgcgctgcgatgattccagcctcagcactgctggcgataatttgatcgtg
caagctgcgcatttattacgtgagcgctcagggttctctgaacttggtgccgcgattgaa
ttgcaaaaacgcatcccaattggagctggtcttgcgggcggctcaagtgatggtgcagca
acactggtggggttaaacggtctctggaatctcaatttttctcagggtcaacttgaaggt
tttgcggctgagcttggctccgatatgcccttttgcctggcaggtggaagccaattgtgt
ttcggtcgtggggaaaggttggaatcgctacaagcgatgcaagcatcaatggccgtggtg
ttggtgaaggatccatcagtgagcgtttcaaccccttgggcttatggacgctgtaaggaa
cttttcaggagtcgttatctttcacaggaatctgattttgagcaacgtcgtcagcagctc
agagaatcttcttggctgaatcctttgcgggctgatgatccaccacctctgcacaacgat
cttcaggctgtggttgcacccgaagtatttgctgtgcaaaccacattgaagttgctcagt
gatttgcctggttctcttgctgtagcgatgagtggatctggtccaagctgttttgccctt
tttgctgacgttgattcagctcaggcagcccttaagcgccaacagcctgccttcgacgca
gctggtttaagcagttggtgctgcgcgttccgctctgaaggcatcaaactggaagcatga

DBGET integrated database retrieval system