KEGG   Prochlorococcus marinus MIT 9303: P9303_18161Help
Entry
P9303_18161       CDS       T00466                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pmf  Prochlorococcus marinus MIT 9303
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    P9303_18161 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    P9303_18161 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    P9303_18161 (trpA)
Enzymes [BR:pmf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     P9303_18161 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1580586..1581422
Genome map
AA seq 278 aa AA seqDB search
MIAMADFLAPKSNTQATISSRFQRVQAEGRLALMPFLMAGDPDLATTAEVLLSLEQSGAD
MIELGIPYSDPLADGPVIQAAASRALASGTTPARVLQMLIDLRGKLSIPVILFTYTNPLF
NRGMERFCDEAAEAGVAGLVVPDLPLEEAERLSPLASARGLDLVLLVAPTTPAERMARIA
ESSRGFTYLVSVTGVTGERSVMEERVESLVQQLKLSGSNPVAVGFGISGPQQVRQVRSWG
ADGAIVGSALVKRMAAAAPGFVAQEAGLFCKELRNAAG
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgattgctatggcagatttcttggcacctaaatccaatacacaagccacaatcagcagt
cgcttccaacgagtacaagctgagggacgccttgcactcatgcctttcctaatggctggt
gatcctgatctggcaaccactgctgaggtattgctcagcctggagcaatctggcgcggac
atgatcgagctgggcattccctatagcgatcctctcgccgatggtccggtgattcaggca
gctgcttctcgagcactggcttctggtacgacaccagctcgggtcttacagatgttgatt
gacttgcggggcaaactttccattcctgtgatcctgttcacctacaccaatccattgttc
aaccggggcatggagcgtttctgtgatgaagcggctgaggctggagttgccggtcttgtg
gtcccagatcttccactcgaggaagctgagcgtctttctcccttggcttctgctcgtgga
cttgatctggttcttctggtggctcctactacacctgcggagcgtatggcaaggattgca
gaaagcagcaggggatttacctatttagtaagcgtgacgggagttactggagaacgttct
gtcatggaggaacgtgttgaatccttggtgcagcaactcaaattgtccggctccaatcct
gtagcagtcggatttggaatttctgggcctcagcaggtacggcaggtgcgaagttggggt
gctgatggagccattgttggcagtgctctagtgaaacgaatggctgctgcggctcctgga
tttgttgctcaagaagcgggtcttttctgcaaagagctgcgcaacgctgctggatga

DBGET integrated database retrieval system