KEGG   Prochlorococcus marinus MIT 9303: P9303_18161Help
Entry
P9303_18161       CDS       T00466                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pmf  Prochlorococcus marinus MIT 9303
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pmf01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:pmf00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:pmf00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1580586..1581422
Genome map
AA seq 278 aa AA seqDB search
MIAMADFLAPKSNTQATISSRFQRVQAEGRLALMPFLMAGDPDLATTAEVLLSLEQSGAD
MIELGIPYSDPLADGPVIQAAASRALASGTTPARVLQMLIDLRGKLSIPVILFTYTNPLF
NRGMERFCDEAAEAGVAGLVVPDLPLEEAERLSPLASARGLDLVLLVAPTTPAERMARIA
ESSRGFTYLVSVTGVTGERSVMEERVESLVQQLKLSGSNPVAVGFGISGPQQVRQVRSWG
ADGAIVGSALVKRMAAAAPGFVAQEAGLFCKELRNAAG
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgattgctatggcagatttcttggcacctaaatccaatacacaagccacaatcagcagt
cgcttccaacgagtacaagctgagggacgccttgcactcatgcctttcctaatggctggt
gatcctgatctggcaaccactgctgaggtattgctcagcctggagcaatctggcgcggac
atgatcgagctgggcattccctatagcgatcctctcgccgatggtccggtgattcaggca
gctgcttctcgagcactggcttctggtacgacaccagctcgggtcttacagatgttgatt
gacttgcggggcaaactttccattcctgtgatcctgttcacctacaccaatccattgttc
aaccggggcatggagcgtttctgtgatgaagcggctgaggctggagttgccggtcttgtg
gtcccagatcttccactcgaggaagctgagcgtctttctcccttggcttctgctcgtgga
cttgatctggttcttctggtggctcctactacacctgcggagcgtatggcaaggattgca
gaaagcagcaggggatttacctatttagtaagcgtgacgggagttactggagaacgttct
gtcatggaggaacgtgttgaatccttggtgcagcaactcaaattgtccggctccaatcct
gtagcagtcggatttggaatttctgggcctcagcaggtacggcaggtgcgaagttggggt
gctgatggagccattgttggcagtgctctagtgaaacgaatggctgctgcggctcctgga
tttgttgctcaagaagcgggtcttttctgcaaagagctgcgcaacgctgctggatga

DBGET integrated database retrieval system