KEGG   Prochlorococcus marinus MIT 9303: P9303_18371Help
Entry
P9303_18371       CDS       T00466                                 

Gene name
glgB
Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pmf  Prochlorococcus marinus MIT 9303
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:pmf00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    P9303_18371 (glgB)
Enzymes [BR:pmf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     P9303_18371 (glgB)
Exosome [BR:pmf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   P9303_18371 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1595656..1597926)
Genome map
AA seq 756 aa AA seqDB search
MTTSVALDWVVQDGQRLAECRHDHPFSLLGPQSHEGQWIVRIWMPEASQVELLCDGRTTA
MTTPNHSWIFEAALNQDPGRTYQLRVKRAGIVHEQHDPWAFHDEWMGEMDRHLFAEGNHH
HIWQRMGAHLMEREGVEGVMFCLWAPRACSVAVLGELNGWDGRHHPMQRRQGGLWELFIP
GFKEGTLYKYEIRTQDGHCYQKADPYGFQHEVRPATSSVVARLDRYQWQDEQWMRQRDSR
NALDQPISVYEMHLGSWIHAATDEPYIELDGTPRAPVLAADMKPGARLLTYPELADQLIP
YVKDRGFTHIELMPISEHPFDGSWGYQVTGWYAPTSRFGSPDEFRAFVDRCHAEGLGVII
DWVPGHFPKDGHGLAFFDGTHLYEHSDPRIGEHKEWGTLIFNYSRNEVRNFLVANLVYWF
EQFHIDGIRVDAVASMLYRDYLRPDGEWIANEDGGRENTEAVRFLQQANHVLFQHFPGAL
SIAEESTTWPMVTQPTDMGGLGFNLKWNMGWMHDMLDYFELDPWFRQFHQNNITFSIWYT
YTENFMLALSHDEVVHGKSNLLHKMPGDDWQKCANVRALLAYMWTHPGKKTIFMGMEFGQ
RSEWNVWGDLQWELLTHDPHKGLQKLVDDLNTFYKAEPALWKDDFDQYGFQWIDCNDNRH
SIISFMRRESSGGTWLVVVANFTPQSHSNYRIGVPIGGYYEEVFNTDSSCYGGRNLGNMG
GKNTDEFNIHGYEQSLELCLPALSVLVFRHDPKRSL
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccagtgttgccctcgactgggtggttcaagacggccaaagacttgctgaatgt
cgccacgatcatcctttctcgctgctgggtcctcaatcccatgaggggcaatggatcgtg
cgcatctggatgccggaggcaagccaagtagagctgctttgtgatggcagaacgactgcc
atgacaacgcccaatcactcctggatcttcgaagcagctctcaaccaagatcccggccgc
acataccagttgcgggttaaacgcgcaggaatcgtgcatgagcagcacgacccctgggcc
ttccacgatgaatggatgggggagatggaccgccacctctttgcggagggcaaccatcac
cacatttggcaacgcatgggcgctcatctgatggagcgtgagggtgttgagggagtgatg
ttctgcctctgggcaccccgtgcatgcagtgtggctgttctcggagaattaaacggatgg
gatggccgtcatcatccgatgcagcgtcgccagggaggcctttgggagctgtttattcct
gggtttaaagaagggaccctttataaatacgaaatccgaacccaggacggccattgctat
cagaaagctgatccttatggtttccagcacgaggtgcgcccagcgacaagctccgtagtc
gccaggcttgatcgctatcaatggcaggacgagcaatggatgcggcaacgggatagtcgt
aatgctctcgatcagccaatttctgtctatgaaatgcatttaggcagctggattcatgca
gcaacagatgaaccgtatatcgagttggatggcacgccccgggcgccggtactcgctgct
gacatgaagcctggagctcgtctcctgacctatcccgaactagccgaccagttaatcccc
tacgtgaaagatcggggattcacccacatcgaactgatgccaatctcagagcatccattt
gatggctcatggggataccaggtcacagggtggtatgcacccaccagccgatttggaagt
ccggatgaattccgtgcatttgttgatcgctgccacgccgaaggtttaggtgtgatcatc
gattgggtgccaggccatttccctaaggatggtcatggcctggccttctttgatggaacc
catctctacgaacattctgatccacgcattggtgaacacaaggaatggggcacgctgatc
ttcaactacagccgcaacgaggtgcgcaactttctcgttgccaatcttgtgtattggttt
gagcaattccatattgatggtattcgtgttgatgcggtggcttcgatgctttatcgcgac
tatctgcgacctgatggagaatggattgccaatgaagatggagggcgagaaaatacagaa
gcagttcgattcctccaacaggccaatcacgttctatttcagcacttcccgggagcactt
tcaattgcggaggagtcaacaacttggcccatggttactcagcccactgatatgggcggc
ctgggattcaaccttaaatggaatatgggttggatgcatgacatgctcgattatttcgag
ttagatccttggtttaggcagtttcaccagaacaacatcactttttcgatctggtatacc
tacaccgaaaacttcatgctggcacttagtcatgatgaggttgtgcatggtaaaagcaat
cttctccataagatgcccggagatgactggcagaaatgtgcaaatgttcgtgcattgctt
gcctatatgtggacccatcctggcaagaaaactatcttcatgggaatggaatttggtcaa
cgatcggaatggaatgtatggggagatctgcaatgggagctgttgacacatgatccacat
aagggtctgcagaaattggttgatgacctcaacactttctataaagccgagcctgctcta
tggaaagatgactttgatcaatatggattccaatggattgattgcaatgataatcgtcat
tctataatcagctttatgcgtcgtgaaagtagtggtggaacttggcttgttgtcgtcgcc
aacttcacaccgcaaagtcattcaaattacagaattggcgtgcctattggtggctattat
gaggaagttttcaacacagatagctcttgttacggcggtagaaatctcggcaatatgggc
ggtaaaaacactgatgaattcaatatccatggatatgagcagtctcttgaactctgccta
ccagcgctgagcgtgctggtcttccgtcatgacccgaagcgaagtctttga

  All links  
No link information was found.   
DBGET integrated database retrieval system