KEGG   Prochlorococcus marinus MIT 9303: P9303_18441Help
Entry
P9303_18441       CDS       T00466                                 

Definition
ROK family protein (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pmf  Prochlorococcus marinus MIT 9303
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    P9303_18441
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    P9303_18441
   00052 Galactose metabolism
    P9303_18441
   00500 Starch and sucrose metabolism
    P9303_18441
   00520 Amino sugar and nucleotide sugar metabolism
    P9303_18441
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    P9303_18441
   00524 Butirosin and neomycin biosynthesis
    P9303_18441
Enzymes [BR:pmf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     P9303_18441
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1606095..1607009
Genome map
AA seq 304 aa AA seqDB search
MATDLAQFIGVDLGGTAIKLGRFDQQGHLLAETELPTPQPSVPGAVTVALCEAIETVDPN
HHAAFVGVGLPGPMDAEGRVARVCINLPGWLEVPLADWLEPRLNRHVTLANDGNCALVGE
AWQGAAQDFQNVVLLTLGTGVGGGVMLGGQLFVGHNGAAAEPGLIGVDSEGPSCNSGNQG
SLEQYASIGALQRLWAGDPEELSERAASGDREALEIWETYGRKLGVGISSLVYVFTPQLV
LVGGGLAGGAIHFLPAVRQEVEKRVQAVSREGLQIRSCALGNGAGRLGAARLALQRLLSV
GNAP
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
ttggcaaccgacttagctcagttcatcggtgtcgatttgggaggtaccgcgatcaagtta
ggtcgatttgatcagcagggacatctgttggcagaaaccgagttgccaacccctcaaccc
tcggtgccaggtgctgtcacagttgctctttgcgaagctatcgaaactgttgatccaaac
catcatgctgcattcgtgggagtgggcttgccaggaccaatggatgctgaagggcgggtc
gccagggtctgtatcaacctgcctggatggctggaggttcctttagccgactggttggaa
ccacgactgaatcggcacgtcaccctggcgaatgatggcaactgtgctctcgttggtgaa
gcatggcagggcgcggcccaagattttcaaaacgtcgttctgctcactcttggcaccgga
gtaggtgggggcgtcatgcttggggggcaattgtttgtcggtcataacggtgctgcagcc
gagcctggtctgattggggtggattcggaaggtcccagctgcaacagtggcaaccaaggc
tccctagagcagtacgccagcattggcgcccttcaacgcctatgggctggggacccagaa
gaattaagcgaacgagctgcttctggcgatcgcgaggctctcgagatctgggaaacctat
ggccgcaaacttggggtgggaatcagttctctcgtctatgttttcacccctcagctggtg
ctggtcggaggaggtcttgcaggtggagcaattcatttcctaccagcggtccgtcaggaa
gtagagaagcgggtgcaagctgtgagcagggagggtttgcagattcgctcctgtgccctt
gggaatggagctggtcgcctgggggcagctcgacttgcccttcaacgtctcttaagtgtc
ggcaatgccccttga

DBGET integrated database retrieval system