KEGG   Prochlorococcus marinus MIT 9303: P9303_18441Help
Entry
P9303_18441       CDS       T00466                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
pmf  Prochlorococcus marinus MIT 9303
Pathway
pmf00010  Glycolysis / Gluconeogenesis
pmf00052  Galactose metabolism
pmf00500  Starch and sucrose metabolism
pmf00520  Amino sugar and nucleotide sugar metabolism
pmf00521  Streptomycin biosynthesis
pmf01100  Metabolic pathways
pmf01110  Biosynthesis of secondary metabolites
pmf01120  Microbial metabolism in diverse environments
pmf01130  Biosynthesis of antibiotics
pmf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    P9303_18441
   00052 Galactose metabolism
    P9303_18441
   00500 Starch and sucrose metabolism
    P9303_18441
   00520 Amino sugar and nucleotide sugar metabolism
    P9303_18441
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    P9303_18441
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    P9303_18441
Enzymes [BR:pmf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     P9303_18441
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ABM78586
CYORF: P9303_18441
UniProt: A2CAS6
Position
1606095..1607009
Genome map
AA seq 304 aa AA seqDB search
MATDLAQFIGVDLGGTAIKLGRFDQQGHLLAETELPTPQPSVPGAVTVALCEAIETVDPN
HHAAFVGVGLPGPMDAEGRVARVCINLPGWLEVPLADWLEPRLNRHVTLANDGNCALVGE
AWQGAAQDFQNVVLLTLGTGVGGGVMLGGQLFVGHNGAAAEPGLIGVDSEGPSCNSGNQG
SLEQYASIGALQRLWAGDPEELSERAASGDREALEIWETYGRKLGVGISSLVYVFTPQLV
LVGGGLAGGAIHFLPAVRQEVEKRVQAVSREGLQIRSCALGNGAGRLGAARLALQRLLSV
GNAP
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
ttggcaaccgacttagctcagttcatcggtgtcgatttgggaggtaccgcgatcaagtta
ggtcgatttgatcagcagggacatctgttggcagaaaccgagttgccaacccctcaaccc
tcggtgccaggtgctgtcacagttgctctttgcgaagctatcgaaactgttgatccaaac
catcatgctgcattcgtgggagtgggcttgccaggaccaatggatgctgaagggcgggtc
gccagggtctgtatcaacctgcctggatggctggaggttcctttagccgactggttggaa
ccacgactgaatcggcacgtcaccctggcgaatgatggcaactgtgctctcgttggtgaa
gcatggcagggcgcggcccaagattttcaaaacgtcgttctgctcactcttggcaccgga
gtaggtgggggcgtcatgcttggggggcaattgtttgtcggtcataacggtgctgcagcc
gagcctggtctgattggggtggattcggaaggtcccagctgcaacagtggcaaccaaggc
tccctagagcagtacgccagcattggcgcccttcaacgcctatgggctggggacccagaa
gaattaagcgaacgagctgcttctggcgatcgcgaggctctcgagatctgggaaacctat
ggccgcaaacttggggtgggaatcagttctctcgtctatgttttcacccctcagctggtg
ctggtcggaggaggtcttgcaggtggagcaattcatttcctaccagcggtccgtcaggaa
gtagagaagcgggtgcaagctgtgagcagggagggtttgcagattcgctcctgtgccctt
gggaatggagctggtcgcctgggggcagctcgacttgcccttcaacgtctcttaagtgtc
ggcaatgccccttga

DBGET integrated database retrieval system