KEGG   Prochlorococcus marinus MIT 9303: P9303_18641Help
Entry
P9303_18641       CDS       T00466                                 

Definition
(GenBank) possible endolysin
  KO
K01185  lysozyme [EC:3.2.1.17]
Organism
pmf  Prochlorococcus marinus MIT 9303
Brite
Enzymes [BR:pmf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     P9303_18641
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transglycosylas
Motif
Other DBs
NCBI-ProteinID: ABM78606
CYORF: P9303_18641
UniProt: A2CAU6
Position
complement(1625320..1625904)
Genome map
AA seq 194 aa AA seqDB search
MGTGQTLQAERIQLPKEHAFRVNVAYQSNGSQRLHYLITPERRALLNTIRYAEGTWKEGK
DLGYRTMFGGGVFEDLSQHPNRVVVKFYSSAAAGAYQFIPSTWMAVAKELNLPNFQPQHQ
DQAALHLVSKRGALKEIDSLGLTHSAMARLAPEWASFPNWAGNSSYGQPVKSHAELAKFY
SANLRQLQQQALAS
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggggactggccagaccttgcaagctgaacgcatccagttgcctaaagaacatgctttt
agggtgaacgttgcttatcaaagcaatggaagccaaaggctgcactatttaataacgccc
gaacgtcgagcccttctgaacaccatccgttatgcagaaggcacttggaaagaaggaaaa
gacctcggatatcgcacaatgtttggagggggtgtctttgaggacctctctcaacacccc
aaccgagttgtggtgaagttctacagcagtgcagcagcaggggcctatcaattcatccca
tcaacttggatggcagtagcgaaggagctgaacttacccaatttccaaccacaacatcaa
gatcaagcagcgctgcacttagttagcaagcgcggtgctctcaaggaaatagattctctt
ggtttaacgcactccgcgatggctcgtcttgcaccggaatgggcttcgtttcctaattgg
gctggcaacagcagttatggacagccagtcaagagccatgcagagttggcaaaattttat
tcagccaatttgcggcaactgcaacagcaggccttagcaagctaa

DBGET integrated database retrieval system