KEGG   Prochlorococcus marinus MIT 9303: P9303_18991Help
Entry
P9303_18991       CDS       T00466                                 

Gene name
acs
Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pmf  Prochlorococcus marinus MIT 9303
Pathway
pmf00010  Glycolysis / Gluconeogenesis
pmf00620  Pyruvate metabolism
pmf00640  Propanoate metabolism
pmf00680  Methane metabolism
pmf01100  Metabolic pathways
pmf01110  Biosynthesis of secondary metabolites
pmf01120  Microbial metabolism in diverse environments
pmf01130  Biosynthesis of antibiotics
pmf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    P9303_18991 (acs)
   00620 Pyruvate metabolism
    P9303_18991 (acs)
   00640 Propanoate metabolism
    P9303_18991 (acs)
  Energy metabolism
   00680 Methane metabolism
    P9303_18991 (acs)
Enzymes [BR:pmf01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     P9303_18991 (acs)
Lipid biosynthesis proteins [BR:pmf01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   P9303_18991 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABM78641
CYORF: P9303_18991
UniProt: A2CAY1
Position
1659612..1661588
Genome map
AA seq 658 aa AA seqDB search
MSPDPSGTIKSVLQEQRVFHPSAELASQSMVGSLEAYRRMAEQAKTDPDSFWGEAARTEL
EWFEPFDSVLDWSNPPFARWFEGGTTNLSFNCLDRHLNGPKADKTALIWEGEPGDVRRFT
YRELHAEVCRAANALKALGIGKGDLVALYMPMVPEAAIAMLACARIGAPHSVVFGGFSAE
ALRDRLVDGEAKAVITADGGFRKDKAVALKPAVDAALAEGACPSVTSVLVVQRTKESVVM
EPGRDQWWHELVSAQSQECAAEPMASEDRLFVLYTSGSTGKPKGVVHSTAGYNLWAHLTF
KWIFDIRDEDVYWCTADVGWITGHSYIVYGPLSNGATTVMYEGAPRPSKPGAFWELIQKH
GITIFYTAPTAIRAFMKSGRAVPDQYDMSSLRLLGTVGEPINPEAWMWYREVIGGDRCPI
VDTWWQTETGGVMISPLPGATPTKPGSATLPLPGIEADVVDAQGEPVDVDEGGYLIVRRP
WPGMMRTVHGNPQRFRESYWEYLRPKDGSFIYFAGDGARRDSDGYFWVMGRVDDVINVSG
HRLGTMEIESALVSHPAVSEAAVVGRPDDLKGEAIVAFVTLEGSREVSDALIQELRVHVG
KEIGPIARPDEIRCSDALPKTRSGKIMRRILRALAAGEEVKGDTSTLEDRSVLDRLRA
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgtcccctgatccatccggcaccattaagtcagtgctgcaggagcagcgcgtctttcat
ccctcagcagagctggcctcacagtcgatggttggcagcctggaagcctatcgtcggatg
gcagagcaagccaaaactgatcctgacagtttctggggtgaagccgcccgcactgagctg
gaatggtttgaaccctttgatagcgttctcgattggtcgaatcctccctttgcgcgttgg
tttgaaggaggcacgacaaatctttccttcaactgtcttgatcgccatctcaatggcccg
aaggcagacaaaacagccctgatctgggagggagagccaggtgatgtgcggcgcttcacc
tatcgagaacttcatgctgaagtgtgcagggctgccaatgcgctgaaagctcttggcatt
ggcaaaggtgacctggttgccctttatatgccaatggtcccagaagcggccattgccatg
ttggcttgcgcccgtatcggagccccacattctgttgtctttggtggcttttccgctgaa
gcccttagagatcgtttggtggatggtgaagccaaagccgtgatcactgctgatggtggt
tttcgtaaagacaaggccgttgccttgaagccggcagtggatgctgcattagccgagggt
gcctgccccagcgtgacgtcggtgctggtggtgcaacgcacgaaagaaagcgtggtgatg
gaacctggtcgagatcagtggtggcacgagcttgtgtcagctcaatctcaagagtgcgcg
gcggaacccatggcgagtgaagatcgcctgtttgtgctctacacctctggctccactgga
aagccaaagggcgttgtgcacagcacggcaggctataacctctgggctcacctcactttc
aagtggatcttcgacattcgcgacgaagacgtctactggtgcacagccgatgtgggctgg
attactggccatagctacattgtttatgggcctctttccaatggggcgacaactgtgatg
tatgagggggcaccacgcccatccaagcctggagccttttgggagttaattcaaaagcac
gggatcacgattttttacaccgcacctacggcaattcgggcattcatgaaaagtggtcgg
gctgtacccgatcaatacgacatgagcagtctgcggttgctaggtaccgtcggagaaccc
atcaatcctgaggcctggatgtggtatcgcgaggtgatcggtggtgatcgttgcccaatt
gtcgacacttggtggcaaacggagacaggtggggtgatgatcagcccattgcctggtgcc
acgccaacaaaaccaggatctgcgacccttcccctaccaggcattgaggctgatgtagtt
gacgcacaaggcgagccggtagacgttgacgaaggtggatatctgatcgtgcgacgtcct
tggccaggaatgatgcgcaccgtgcacggaaatcctcaacgctttagggagagctattgg
gaatacctacgccctaaggatggcagtttcatctatttcgcaggcgatggagctcgtcga
gatagtgatggttatttctgggtgatgggcagggtggatgatgtgattaacgtttcaggc
catcgtcttggcacgatggaaatcgaatcggcattggtgagtcacccggcagtgtctgaa
gcggcagtggttggaaggcctgatgaccttaaaggtgaagcgatcgtggccttcgtcacc
ttggagggaagcagggaagtgagtgatgctttgattcaggagcttcgtgttcatgtgggc
aaggaaatcggccccattgctcgacctgatgagatccgttgcagtgatgccttacccaag
acccgcagcggcaaaattatgcgccgtatcttgcgggctttggccgctggagaggaggtc
aagggtgataccagcaccctggaagatcgctccgtgctggatcggcttagagcctga

DBGET integrated database retrieval system