KEGG   Prochlorococcus marinus MIT 9303: P9303_18991Help
Entry
P9303_18991       CDS       T00466                                 

Gene name
acs
Definition
acetyl-coenzyme A synthetase (EC:6.2.1.17 6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pmf  Prochlorococcus marinus MIT 9303
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pmf01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pmf00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pmf00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:pmf00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:pmf00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1659612..1661588
Genome map
AA seq 658 aa AA seqDB search
MSPDPSGTIKSVLQEQRVFHPSAELASQSMVGSLEAYRRMAEQAKTDPDSFWGEAARTEL
EWFEPFDSVLDWSNPPFARWFEGGTTNLSFNCLDRHLNGPKADKTALIWEGEPGDVRRFT
YRELHAEVCRAANALKALGIGKGDLVALYMPMVPEAAIAMLACARIGAPHSVVFGGFSAE
ALRDRLVDGEAKAVITADGGFRKDKAVALKPAVDAALAEGACPSVTSVLVVQRTKESVVM
EPGRDQWWHELVSAQSQECAAEPMASEDRLFVLYTSGSTGKPKGVVHSTAGYNLWAHLTF
KWIFDIRDEDVYWCTADVGWITGHSYIVYGPLSNGATTVMYEGAPRPSKPGAFWELIQKH
GITIFYTAPTAIRAFMKSGRAVPDQYDMSSLRLLGTVGEPINPEAWMWYREVIGGDRCPI
VDTWWQTETGGVMISPLPGATPTKPGSATLPLPGIEADVVDAQGEPVDVDEGGYLIVRRP
WPGMMRTVHGNPQRFRESYWEYLRPKDGSFIYFAGDGARRDSDGYFWVMGRVDDVINVSG
HRLGTMEIESALVSHPAVSEAAVVGRPDDLKGEAIVAFVTLEGSREVSDALIQELRVHVG
KEIGPIARPDEIRCSDALPKTRSGKIMRRILRALAAGEEVKGDTSTLEDRSVLDRLRA
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgtcccctgatccatccggcaccattaagtcagtgctgcaggagcagcgcgtctttcat
ccctcagcagagctggcctcacagtcgatggttggcagcctggaagcctatcgtcggatg
gcagagcaagccaaaactgatcctgacagtttctggggtgaagccgcccgcactgagctg
gaatggtttgaaccctttgatagcgttctcgattggtcgaatcctccctttgcgcgttgg
tttgaaggaggcacgacaaatctttccttcaactgtcttgatcgccatctcaatggcccg
aaggcagacaaaacagccctgatctgggagggagagccaggtgatgtgcggcgcttcacc
tatcgagaacttcatgctgaagtgtgcagggctgccaatgcgctgaaagctcttggcatt
ggcaaaggtgacctggttgccctttatatgccaatggtcccagaagcggccattgccatg
ttggcttgcgcccgtatcggagccccacattctgttgtctttggtggcttttccgctgaa
gcccttagagatcgtttggtggatggtgaagccaaagccgtgatcactgctgatggtggt
tttcgtaaagacaaggccgttgccttgaagccggcagtggatgctgcattagccgagggt
gcctgccccagcgtgacgtcggtgctggtggtgcaacgcacgaaagaaagcgtggtgatg
gaacctggtcgagatcagtggtggcacgagcttgtgtcagctcaatctcaagagtgcgcg
gcggaacccatggcgagtgaagatcgcctgtttgtgctctacacctctggctccactgga
aagccaaagggcgttgtgcacagcacggcaggctataacctctgggctcacctcactttc
aagtggatcttcgacattcgcgacgaagacgtctactggtgcacagccgatgtgggctgg
attactggccatagctacattgtttatgggcctctttccaatggggcgacaactgtgatg
tatgagggggcaccacgcccatccaagcctggagccttttgggagttaattcaaaagcac
gggatcacgattttttacaccgcacctacggcaattcgggcattcatgaaaagtggtcgg
gctgtacccgatcaatacgacatgagcagtctgcggttgctaggtaccgtcggagaaccc
atcaatcctgaggcctggatgtggtatcgcgaggtgatcggtggtgatcgttgcccaatt
gtcgacacttggtggcaaacggagacaggtggggtgatgatcagcccattgcctggtgcc
acgccaacaaaaccaggatctgcgacccttcccctaccaggcattgaggctgatgtagtt
gacgcacaaggcgagccggtagacgttgacgaaggtggatatctgatcgtgcgacgtcct
tggccaggaatgatgcgcaccgtgcacggaaatcctcaacgctttagggagagctattgg
gaatacctacgccctaaggatggcagtttcatctatttcgcaggcgatggagctcgtcga
gatagtgatggttatttctgggtgatgggcagggtggatgatgtgattaacgtttcaggc
catcgtcttggcacgatggaaatcgaatcggcattggtgagtcacccggcagtgtctgaa
gcggcagtggttggaaggcctgatgaccttaaaggtgaagcgatcgtggccttcgtcacc
ttggagggaagcagggaagtgagtgatgctttgattcaggagcttcgtgttcatgtgggc
aaggaaatcggccccattgctcgacctgatgagatccgttgcagtgatgccttacccaag
acccgcagcggcaaaattatgcgccgtatcttgcgggctttggccgctggagaggaggtc
aagggtgataccagcaccctggaagatcgctccgtgctggatcggcttagagcctga

DBGET integrated database retrieval system