KEGG   Prochlorococcus marinus MIT 9303: P9303_19831Help
Entry
P9303_19831       CDS       T00466                                 

Definition
hypothetical protein
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
pmf  Prochlorococcus marinus MIT 9303
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmf00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    P9303_19831
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    P9303_19831
Enzymes [BR:pmf01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     P9303_19831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1742859..1743776
Genome map
AA seq 305 aa AA seqDB search
MPAALSISQEILKPHLEIQGGHTLSRELKVSGAKNSALVLMTSALLSEGPLELHNVPQLT
DIQGMADILASLGVRVKRSQETVWLQADDLHHAEPPYDLVNGLRASFFCIGPLLGRLGHA
KVPLPGGCRIGARPVVEHIRGLKALGAMVKVEHGVVTASVPGTSRRLKGAAIVLDCPSVG
ATETILMAAVLAEGTSTIENAAQEPEVQDLAKMLNAMGARVSGAGGPIITIEGVERLHGC
NYSVIPDRIEAGTFLIAAAITRSIVRVSPVIPEHLNAVLQKLRDAAAPLRLTSKESRLSR
EICMA
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcagcgttatccatatctcaagagattctcaagcctcatctggagattcaaggc
ggacatactctttccagagagctgaaagtcagcggagctaagaattctgccctcgtgctg
atgacctcagcccttctcagcgaaggccctcttgagctgcataatgttccccagctcaca
gatatacaggggatggcagacatcctcgcctccttgggggtacgtgtaaaacgtagtcag
gagaccgtttggctacaggctgatgaccttcatcacgccgaacctccctacgatctagtc
aatggactgagagctagctttttctgcatcggcccactgctaggacgactcggtcacgcc
aaagtccccctgccgggtggttgccgcatcggagcccggcctgttgttgagcacatcaga
gggcttaaagctcttggtgccatggtgaaagttgagcatggcgttgtcacagcttcagta
ccaggaacgtcacgacgacttaaaggtgctgcaatcgtgctcgactgcccaagtgtcggt
gcaaccgagaccattctcatggcagctgtgttggcagaaggcactagcaccatcgaaaac
gctgcccaggaacctgaggttcaagacctggccaaaatgctcaatgccatgggtgctcgt
gtaagcggtgctggtggtccaatcatcaccatcgaaggcgttgaacgtttacacggctgc
aactattcggtgatccctgatcgcattgaagcagggaccttcctaatagcagcggcaatc
acccgctcgattgttcgagtgtctccagtcatccctgagcatctcaatgccgtgctccag
aaactgagagatgcggctgcacccttgagattgacaagcaaggaatcacgcttatcccgg
gagatctgcatggcgtga

DBGET integrated database retrieval system