KEGG   Prochlorococcus marinus MIT 9303: P9303_21601Help
Entry
P9303_21601       CDS       T00466                                 

Definition
methionine salvage pathway enzyme E-2/E-2'-like protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
pmf  Prochlorococcus marinus MIT 9303
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmf00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    P9303_21601
Enzymes [BR:pmf01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     P9303_21601
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     P9303_21601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1919014..1919670
Genome map
AA seq 218 aa AA seqDB search
MKQQGSTKPNETFSRRSKTPRSRWLQRPLQPLGMSRLSIHPEGNTNATSPAEPLLESDDP
AVIKAELAKRGIEFQHWPAKVKLHQNSIESDILAAYAVEIARVQADGRYPTVDAIRITPD
HPDREALRQKFLAEHTHAEDEVRFFVEGRGLFCLHIGAEVLQVLCEQNDCINVPAGTRHW
FDMGSKPQFCAVRFFDNPEGWIASFTGDAIAERFAKLP
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacagcagggctcgacaaagccgaacgaaacattcagccgtcgttctaagacgcca
cgatcaagatggctgcaaagaccccttcaacctctgggaatgagtcgcctcagcatccac
cccgaaggcaacaccaacgccacaagcccggcggaacccttattggagagcgatgatcct
gcagtgatcaaagccgagctggccaaacggggcattgaattccagcattggccagccaaa
gtcaagctccatcagaactcaatcgagtcagacatccttgcggcctacgccgtcgagatc
gcccgagtgcaggctgatggccgttaccccacggtggatgcaatccgaatcacgccagac
caccccgatcgtgaagcactgcgccaaaaattcttagccgaacacacccatgccgaagac
gaggttcgcttctttgtagaaggccgtggcttgttctgcttacacatcggcgctgaagtg
ctgcaagtgctgtgcgaacaaaacgactgcatcaacgtgcctgccggaactcgccattgg
ttcgatatgggcagcaagccacagttttgtgctgtgcgcttcttcgataacccagaaggc
tggattgcaagcttcacaggggatgcgatcgccgagagattcgccaaactgccataa

DBGET integrated database retrieval system