KEGG   Prochlorococcus marinus MIT 9303: P9303_27051Help
Entry
P9303_27051       CDS       T00466                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pmf  Prochlorococcus marinus MIT 9303
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    P9303_27051 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    P9303_27051 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    P9303_27051 (trpB)
Enzymes [BR:pmf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     P9303_27051 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(2387346..2388611)
Genome map
AA seq 421 aa AA seqDB search
MPGVPVTSTLPSQPKDADLAVSARPSAQGRFGRYGGQYVPETLMPALAELEQAAALAWKD
PAFTAELDRLLRSYVGRATPLYEAERLTAHYCRSDGGPRIWLKREDLNHTGAHKINNALG
QALLALRMGKKRIIAETGAGQHGVATATVCARFGLECVVYMGAEDMRRQALNVFRMRLLG
ATVQPVTAGTATLKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMLVRDFHAVIGQEAR
QQCAEAFGRLPDVLLACVGGGSNAMGLFHPFVQERSVRMIGVEAAGDGVETGRHAATITE
GRVGVLHGAMSLLLQDDEGQVQEAHSISAGLDYPGVGPEHSYLCEIGRAEYAAVSDQQAL
DALRLVSELEGIIPALETAHAFAWLETLCPTLAAGTEVVINCSGRGDKDVNTVAEKLGNQ
L
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
ttgcctggcgtaccggtgaccagcactttgccctctcagcccaaagatgcggacctcgct
gtgagtgcgcgaccttctgcccaggggcgtttcggcagatatgggggccagtacgtgccc
gaaaccttgatgcctgccttggctgaactggagcaagcagctgcgctggcatggaaagat
cctgccttcactgctgagttggatcggctgctgcgtagctatgtgggtcgggcgacgccg
ctttatgaggctgagcgcctcacagctcattactgccgttcagacggaggacccaggatc
tggctgaagcgtgaggatctcaatcacacaggcgcccacaaaatcaataacgctttgggt
caggctctgttggcgttacgcatgggtaaaaagcggatcattgccgaaacaggtgcgggt
caacacggtgtggccacggccacggtgtgtgcccgctttggtcttgagtgtgttgtttac
atgggcgctgaggacatgcgccgtcaggcgttgaatgtgttccgcatgcgtctgcttggg
gccacagtgcagcctgtcactgcaggcacggcaacgctgaaggacgcgacgagtgaggcg
attcgtgattgggtcaccaatgtggaaaccacccattacatccttggttcggtggctggt
ccccatccctatccgatgcttgttcgcgactttcatgccgtgatcggtcaggaggccagg
cagcagtgtgctgaggctttcggtcgcttgcctgatgttcttttggcgtgcgttggtgga
gggtccaatgccatgggtttgtttcatcccttcgtgcaggagcgctctgtgcgcatgatt
ggagttgaagctgctggtgatggtgttgaaactggtcgtcatgcggcaacaatcaccgaa
ggtcgagtaggcgtcttgcatggagcgatgagtttgttgcttcaggatgatgaaggtcag
gtgcaagaagcccattcgattagtgccggcctcgactacccgggagttggtccagaacac
agctacttatgtgagattggtcgggcggagtatgccgcggttagcgatcagcaggctttg
gatgccttgcgcttggtgagtgaactagagggaattattcctgctttagagacggcccat
gcctttgcttggttagagacgctttgccccactcttgccgctggaacagaagtggtgatc
aattgctcaggccgcggcgataaggatgtcaacaccgtggcagagaaacttggcaatcag
ctttga

DBGET integrated database retrieval system