KEGG   Prochlorococcus marinus MIT 9303: P9303_29511Help
Entry
P9303_29511       CDS       T00466                                 

Gene name
speB
Definition
arginase family (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
pmf  Prochlorococcus marinus MIT 9303
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:pmf00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    P9303_29511 (speB)
Enzymes [BR:pmf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     P9303_29511 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2610089..2611003
Genome map
AA seq 304 aa AA seqDB search
MTQNTTTTQARFDSEGAIFMAARRDPTGCNVGLFGVPYDGTSSFRPGSRFGPAAIRDVSN
GLETYCPQLDLDLEEIAFTDLGALDIPFGDPKPVVEAVKKATQNVLQMGLRPLMLGGEHS
ISSGAVAAITESHSDLVLLQLDAHADLRQEYLGARHSHACAMRRCLEVLPSAQLLQLAIR
SGTRAEFQELHDQQRLVNHNPGQAATDLAKALAPHQGKPLYLTVDLDWFDPSVLPGTGTP
EPGGFLWRDFAAVVDVIRHHQLVGADVVELAPQLDPSGMSSVLGAKVTRSLLMLLSLCAT
SEQN
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgacccaaaacacaacaaccactcaagcaagattcgacagcgaaggtgccatcttcatg
gctgcccgtcgcgaccctaccggttgcaacgtcggactttttggcgtgccttacgacggc
acctcttcattccgtccaggcagccgcttcggtccggcagccatccgcgacgtcagcaac
ggcctagaaacctactgccctcagcttgatctggatctagaagagattgccttcaccgat
cttggcgcccttgacattcccttcggcgaccctaagcccgttgtagaagcagtcaaaaaa
gccacccaaaacgtgctgcagatgggtctcaggccgctgatgctaggcggcgagcactcg
atcagctccggagcagtggctgcaatcactgaatctcattcagatctcgtgctgttgcaa
ctggatgcacatgcagacctccgccaagaatatctaggtgcgcgacacagccatgcctgt
gccatgcgccgttgcctcgaggtactgcccagcgctcagctgctgcagttagcaatccgc
agtggcacacgcgcagaatttcaggaactacacgatcagcaacggctggtgaaccacaac
cctggccaagcagcgactgatctagctaaagcccttgcaccccatcaaggcaaacctctc
tatctcaccgtggatttggattggttcgacccatccgtactgccggggaccgggacacct
gaaccaggcggttttctatggcgcgattttgccgccgtcgtggatgtaatacgacaccat
cagcttgtcggcgccgacgtggtggaactcgccccccaacttgatccttcagggatgagt
agtgtgctcggcgccaaggtgacccgcagcctgctcatgctgctcagcctgtgtgcaaca
tctgagcaaaattga

DBGET integrated database retrieval system