KEGG   Prochlorococcus marinus MIT 9303: P9303_30231Help
Entry
P9303_30231       CDS       T00466                                 

Gene name
thrC
Definition
(GenBank) Threonine synthase: Pyridoxal-5'-phosphate-dependent enzymes, beta family protein
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
pmf  Prochlorococcus marinus MIT 9303
Pathway
pmf00260  Glycine, serine and threonine metabolism
pmf00750  Vitamin B6 metabolism
pmf01100  Metabolic pathways
pmf01110  Biosynthesis of secondary metabolites
pmf01120  Microbial metabolism in diverse environments
pmf01230  Biosynthesis of amino acids
Module
pmf_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pmf00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    P9303_30231 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    P9303_30231 (thrC)
Enzymes [BR:pmf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     P9303_30231 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Peripla_BP_6
Motif
Other DBs
NCBI-ProteinID: ABM79753
CYORF: P9303_30231
UniProt: A2CE43
Position
2681412..2682470
Genome map
AA seq 352 aa AA seqDB search
MQDWPGLIEAYRSWLPVSDTTPVVTLKEGATPLIPVNSIAERIGRGVKVYVKYDGLNPTG
SFKDRGMTMAISKAKEANCEGVICASTGNTSAAAAAYARRAGMRAFVLIPDGYVAQGKLA
QALVYGSEVLAIRGNFDRALDIVQEMALKYPVTLVNSVNPYRLQGQKTAAFEIVDALGEA
PEWLCIPMGNAGNITAYWMGFQEYKQAGKCQLLPQMMGFQASGSAPLVFNKTVNNPNTIA
TAIRIGNPVNKEKAIAAKSSSNGAFLDVSDEKIIEAYKLLGREEGIFCEPASAASVAGLL
KRASEVPSGATVVCVLTGNGLKDPDCAINNNDATFHADLNPDLTTVARVMGF
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgcaggattggcctggcctaatagaagcgtatagatcctggttgcccgtaagcgatacc
acacctgtcgtgactctcaaagaaggagcgacgccattgatccctgtcaactccatagct
gaacggattggcaggggagtcaaggtctacgtgaaatacgacggcctcaaccccacaggg
tcctttaaggaccgaggcatgacgatggcgatcagcaaggccaaagaagctaattgtgaa
ggagtcatatgtgccagtacaggcaacacatctgctgctgctgctgcatatgcaagacgc
gctggcatgcgtgcttttgtattaattccagacggttatgtagcgcaaggaaagctagct
caagctttagtttatggctccgaggtgctagcaattcgaggcaattttgatcgtgctctc
gacattgttcaagaaatggccttgaaatacccagtaactctagtgaattccgtcaaccca
tacaggcttcaaggtcaaaaaactgcagcctttgaaattgttgatgctctcggagaagca
ccggaatggctttgcatcccaatggggaatgcaggcaatatcactgcgtattggatgggt
tttcaagagtacaaacaagccggaaaatgtcaacttctaccacaaatgatgggattccaa
gcaagtggatctgctccattagttttcaataaaaccgtaaacaatccaaatacaatcgca
acggcaattagaataggcaacccagtcaacaaagaaaaagctattgccgcaaaatcaagc
agcaatggagcctttcttgatgtttcagatgaaaaaataatagaagcttacaaattactt
ggtcgagaggaaggcattttctgtgaacctgcaagtgctgcttctgtagcaggattatta
aaacgtgcttctgaagtcccttcaggggcaactgttgtatgtgtccttactggcaacggt
ttaaaagatccagattgtgccatcaataacaacgatgcaacatttcatgcagatctaaat
ccagatctgaccactgtggctcgtgtcatgggcttttaa

DBGET integrated database retrieval system