KEGG   Prochlorococcus marinus MIT 9303: P9303_30231Help
Entry
P9303_30231       CDS       T00466                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pmf  Prochlorococcus marinus MIT 9303
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pmf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    P9303_30231 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    P9303_30231 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    P9303_30231 (thrC)
Enzymes [BR:pmf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     P9303_30231 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2681412..2682470
Genome map
AA seq 352 aa AA seqDB search
MQDWPGLIEAYRSWLPVSDTTPVVTLKEGATPLIPVNSIAERIGRGVKVYVKYDGLNPTG
SFKDRGMTMAISKAKEANCEGVICASTGNTSAAAAAYARRAGMRAFVLIPDGYVAQGKLA
QALVYGSEVLAIRGNFDRALDIVQEMALKYPVTLVNSVNPYRLQGQKTAAFEIVDALGEA
PEWLCIPMGNAGNITAYWMGFQEYKQAGKCQLLPQMMGFQASGSAPLVFNKTVNNPNTIA
TAIRIGNPVNKEKAIAAKSSSNGAFLDVSDEKIIEAYKLLGREEGIFCEPASAASVAGLL
KRASEVPSGATVVCVLTGNGLKDPDCAINNNDATFHADLNPDLTTVARVMGF
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgcaggattggcctggcctaatagaagcgtatagatcctggttgcccgtaagcgatacc
acacctgtcgtgactctcaaagaaggagcgacgccattgatccctgtcaactccatagct
gaacggattggcaggggagtcaaggtctacgtgaaatacgacggcctcaaccccacaggg
tcctttaaggaccgaggcatgacgatggcgatcagcaaggccaaagaagctaattgtgaa
ggagtcatatgtgccagtacaggcaacacatctgctgctgctgctgcatatgcaagacgc
gctggcatgcgtgcttttgtattaattccagacggttatgtagcgcaaggaaagctagct
caagctttagtttatggctccgaggtgctagcaattcgaggcaattttgatcgtgctctc
gacattgttcaagaaatggccttgaaatacccagtaactctagtgaattccgtcaaccca
tacaggcttcaaggtcaaaaaactgcagcctttgaaattgttgatgctctcggagaagca
ccggaatggctttgcatcccaatggggaatgcaggcaatatcactgcgtattggatgggt
tttcaagagtacaaacaagccggaaaatgtcaacttctaccacaaatgatgggattccaa
gcaagtggatctgctccattagttttcaataaaaccgtaaacaatccaaatacaatcgca
acggcaattagaataggcaacccagtcaacaaagaaaaagctattgccgcaaaatcaagc
agcaatggagcctttcttgatgtttcagatgaaaaaataatagaagcttacaaattactt
ggtcgagaggaaggcattttctgtgaacctgcaagtgctgcttctgtagcaggattatta
aaacgtgcttctgaagtcccttcaggggcaactgttgtatgtgtccttactggcaacggt
ttaaaagatccagattgtgccatcaataacaacgatgcaacatttcatgcagatctaaat
ccagatctgaccactgtggctcgtgtcatgggcttttaa

DBGET integrated database retrieval system