KEGG   Prochlorococcus marinus MIT 9301: P9301_01301Help
Entry
P9301_01301       CDS       T00488                                 

Gene name
hemD
Definition
uroporphyrinogen III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pmg  Prochlorococcus marinus MIT 9301
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pmg00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
123565..124362
Genome map
AA seq 265 aa AA seqDB search
MPKVNLPLDQRNIIITRSKEGILDIKKIFTSKGANVFDLPAISIGDPDDLNPLDEALNQI
NDFHWIIFSSSNGIKFVDKRLRYFNSSLKECSKKTKIAVVGEKTSKTLDDFGIKADFIPP
EFVAESLIDNFPVSGYGLRVFVPRVQTGGRDLIADQFRMAGARVFEVAAYETRCPDSIPE
ETIDIISNRKVDAIIFSSGKTVVNAAFLLEKKLGKQWLDYFDQIKLLSIGPQTTKICNKI
FGRVDSQAQKYTFEGLLDLAINIFS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaagttaatctaccccttgatcaaagaaatataataattactcgatcaaaagaa
gggatattggatataaaaaagattttcacaagcaagggcgctaatgtatttgatttgcct
gcaataagtattggtgatcctgatgatttgaatcctcttgacgaagcattaaatcaaata
aatgattttcattggattattttttccagtagtaatgggattaaatttgtagataaaaga
cttagatactttaatagttcattaaaagaatgttctaaaaaaacaaaaatagccgtagtc
ggagaaaaaacctctaaaactcttgatgattttgggattaaggctgatttcatacctcca
gaatttgttgctgaaagtttaattgataatttcccagtatctggttatggacttcgagtt
tttgtaccaagagttcagacaggtggtagggatctaattgcagatcaatttagaatggct
ggtgctcgtgtatttgaggttgctgcatatgaaactagatgtcctgactcaattccggaa
gaaacaattgatattatttctaatcgaaaagtagatgcaattattttctcaagcggtaaa
accgtagtaaatgctgcttttttactagaaaaaaaacttggtaaacaatggttagattat
tttgatcagattaagttgttatctattggacctcagacaacaaaaatatgtaacaagatt
tttggaagagttgatagtcaggcacaaaaatatacctttgaaggactgctagatctggca
attaatatttttagttag

DBGET integrated database retrieval system