KEGG   Prochlorococcus marinus MIT 9301: P9301_03121Help
Entry
P9301_03121       CDS       T00488                                 

Gene name
chlD
Definition
protoporphyrin IX magnesium chelatase subunit ChlD (EC:6.6.1.1 6.6.1.2)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
pmg  Prochlorococcus marinus MIT 9301
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pmg00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
286812..288947
Genome map
AA seq 711 aa AA seqDB search
MKSKDSFRAFPLAAITGHSLLKLSLLLAAVDPSLGGVIIAGGRGTGKSVLARGLHTLLPP
IEVLDNELILEKLTEKNSGTSLRPIGRNLDPDKPEEWDISTNKLMEEVIGSDYLNQIDEI
PKKVREAPFIQVPIGITEDRLVGSIDVAASLSTGEQVFQPGILAEAHRGVLYVDDINLLD
DGIVNLILEATGREKNNIERDGLSLSHPCKSLLIATYNPEEGALRDHVLDRFAIVLSADQ
SIDNAQRVEITKSVLSHAENNIKFSEKWSEESDNLSTQLILARQWLKDVKITKEQITYLV
NEALRGGVEGHRSELFAVKVAKANAALRGDENVNSEDLKVAVRLVILPRAMQIPPDDDDI
QPPPPEDQSPPPPPQSNNEESEPETSENDNEQDKEQEEDNSDGEEESTPEIPEEFILDPE
ACMVDPDLLLFSSAKAKAGNSGSRSVIFSDSRGRYVKPIIPRGKVKRIAVDATLRAAAPY
QKSRRLRNPNKSIVIEENDFRSKLLQKKAGALVIFLVDASGSMALNRMQSAKGAVIRLLT
EAYENRDEVALIPFRGNQAEVLLPPTRSITAAKRRLETMPCGGGSPLAHGLTQSAKVAKN
ALATGDIGQVIVVGITDGRGNVPLGLSLGQNEVEGKDNENENVNLKQEVLDIAAKYPMLG
IKLLVIDTERKFIASGFGKELAEAAQGKYVQLPKATDKAIAAMALNAINEF
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcaaaggattcttttagagctttccctttggccgcaattactggtcatagctta
ttgaaattatctttacttttggcagcagttgatcccagtttagggggagtgattattgct
ggaggaagaggtactggtaagtcagtattagcaaggggtttacatactttacttcctcct
attgaggtattagataatgaattaatactggaaaagctaactgagaaaaatagtggaact
tcattaagacctattggtaggaacctagatccagataagccagaggaatgggatattagt
actaataaattaatggaggaggtaattggaagtgattatttgaatcaaattgatgaaatt
cccaaaaaggtaagagaggctccatttattcaagttccaattggcataactgaagacagg
cttgttggatcaattgacgtcgctgcatcattaagtacaggagaacaagtttttcaacct
ggaattttagcagaggctcatagaggtgttctttatgtagacgatataaatttattggat
gatgggattgtaaatttaattcttgaagctacaggaagagagaaaaataatattgaaaga
gatggcttaagcctttctcatccttgtaagtcacttttaatagcaacttataatccagaa
gaaggtgctttgagagatcatgttttagatcgttttgctattgtgctttccgcagatcaa
tctattgataatgctcaaagagttgagattacaaaatctgttttatcacacgcggaaaat
aatattaaattttcagaaaaatggtcggaagaatccgataatttatctactcaattaatt
ttggcaaggcagtggttaaaggatgtcaagataacaaaagagcaaataacctatttagtg
aatgaagctcttagaggaggagtagaaggacataggtcagaattattcgcagtaaaagta
gcaaaggctaatgcagctcttcgaggcgatgagaatgtgaattctgaagatctaaaagtc
gcagtaaggttagttattcttccacgagcaatgcaaatacctccagacgatgatgatatt
caaccaccccctccagaggatcagagccccccacccccgcctcaatcaaataatgaagag
tctgaacctgagactagtgaaaatgataatgagcaagacaaagaacaagaagaagataat
tctgatggagaagaagaatctactcccgaaatacctgaagaattcatattagaccctgaa
gcatgtatggttgatcctgatttattgcttttttcatcagctaaagctaaagcaggaaat
agcggaagtagatcagtcatattcagtgatagcagaggaagatatgtaaaacctattatt
ccaagaggtaaagtaaaaagaattgctgtagatgctacccttcgagctgctgctccttat
caaaaatcgagaagattaaggaaccctaacaaatcaatagttattgaagaaaatgacttt
agatcaaagcttcttcaaaaaaaggcgggggccttagtaatttttctagttgatgctagt
ggctctatggctttaaatagaatgcaaagtgcaaaaggcgctgtaattagacttttaaca
gaagcatatgagaatagagatgaagtagctcttattccttttagaggtaatcaggccgaa
gtgcttttgcctccaacaagatcaataactgctgcaaaaagaaggttggaaacaatgcct
tgtggtggaggttcccctttggcacatggattaacacaatcagcaaaagtagcaaaaaat
gctcttgcaactggagatataggtcaagttattgttgtagggatcactgacggtcgagga
aatgtaccattaggattatctttaggacaaaatgaggttgagggaaaagataacgaaaat
gaaaatgtcaatttaaaacaggaggttctagatatagctgcaaagtatcccatgctcggg
ataaaactcttagtaattgatacagagagaaaatttatagcaagtggatttggtaaagaa
ttagcagaggctgctcaagggaaatacgtccaattgcccaaagctacagataaagcgatt
gcagctatggctttaaatgctataaatgaattctaa

DBGET integrated database retrieval system