KEGG   Prochlorococcus marinus MIT 9301: P9301_03421Help
Entry
P9301_03421       CDS       T00488                                 

Gene name
psbM
Definition
(GenBank) possible Photosystem II reaction center M protein (PsbM)
  KO
K02714  
photosystem II PsbM protein
Organism
pmg  Prochlorococcus marinus MIT 9301
Pathway
Photosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmg00001]
 Metabolism
  Energy metabolism
   00195 Photosynthesis
    P9301_03421 (psbM)
Photosynthesis proteins [BR:pmg00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Other common subunits
    P9301_03421 (psbM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
312834..312986
Genome map
AA seq 50 aa AA seqDB search
METTNFGFVASLLFVGVPTIFLIGLFISTQDGEKSSFYSDSSKGRLGPKR
NT seq 153 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaactaattttggattcgtagctagtcttttatttgtaggggtgccaacaata
ttcctaataggtttatttatttctacacaagatggagaaaaatcaagcttttactctgac
tctagtaaaggtagacttggaccaaaacgctaa

DBGET integrated database retrieval system