KEGG   Prochlorococcus marinus MIT 9301: P9301_04241Help
Entry
P9301_04241       CDS       T00488                                 

Gene name
pdhC
Definition
(GenBank) Dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pmg  Prochlorococcus marinus MIT 9301
Pathway
pmg00010  Glycolysis / Gluconeogenesis
pmg00020  Citrate cycle (TCA cycle)
pmg00620  Pyruvate metabolism
pmg01100  Metabolic pathways
pmg01110  Biosynthesis of secondary metabolites
pmg01120  Microbial metabolism in diverse environments
pmg01130  Biosynthesis of antibiotics
pmg01200  Carbon metabolism
Module
pmg_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pmg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    P9301_04241 (pdhC)
   00020 Citrate cycle (TCA cycle)
    P9301_04241 (pdhC)
   00620 Pyruvate metabolism
    P9301_04241 (pdhC)
Enzymes [BR:pmg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     P9301_04241 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding MadL
Motif
Other DBs
NCBI-ProteinID: ABO17047
CYORF: P9301_04241
UniProt: A3PBC2
Position
369312..370679
Genome map
AA seq 455 aa AA seqDB search
MSHEIFMPALSSTMTEGKIVEWLKNPGDKVERGESVLVVESDKADMDVESFQDGYLAAVL
MPAGSTAPVGETIGLIVENEDEIASVQEQNKGNQPEVSSSDQLELVSNKTEEKPVVQSEI
VEKQEKEVVLMNEKAASSFNSDQINAATSNVSSRVIASPRAKKLASQMGVDLAKVHGSGP
HGRIQADDILKANGQPVSIPWIGEGGSPASIPGANLGVESKPETSGNSFGNPGEIVQFNT
LQKAVNKNMESSLDVPCFRVGYSINTDKLDNFYKKVKQNGVTMTALLVKAVAKTLKKHPQ
VNSSFSENGISYPENINIAVAVAMEDGGLITPVLKEPCNTDLFELSREWKDLVKRSRSKQ
LEPDEYSTGTFTLSNLGMFGVDRFDAILPPGTGAILAIASSKPTVVANSDGSISVKKIMQ
VNLTADHRVIYGADGASFLKDLASLIEDEPETLVS
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgtctcacgaaatattcatgcctgccttgagttctactatgacggagggcaagattgtg
gaatggttgaaaaatccaggagataaagttgaaagaggtgaatctgtcttggttgttgaa
tctgacaaggcagatatggatgttgaatcttttcaagatggatatcttgcggctgtttta
atgcctgctggcagcactgcaccagtgggagagactattggccttatcgtagaaaatgag
gatgagatagcttctgttcaagaacaaaataaaggaaatcaacccgaagtttctagttcg
gatcaacttgaattggtaagcaataaaactgaagaaaaacctgtagttcaaagtgaaatt
gttgaaaaacaagaaaaagaagtcgtattaatgaatgaaaaggcagcatcatcttttaac
agtgatcaaataaatgctgctacgagtaatgtttcttcgagggtgattgcatctccaaga
gctaaaaaacttgcctctcaaatgggtgttgatttagcaaaggttcatggatccggacct
cacggaaggattcaagccgatgatattttaaaagctaatggccaaccagtctctatacca
tggataggtgaaggtggttctcctgcaagtatacctggtgcaaatttgggagttgaaagt
aaaccagaaacttcaggaaatagttttggtaatcccggagaaatagttcaatttaatact
cttcaaaaagcggtaaataaaaatatggaatctagtttagatgtgccatgttttagggtg
ggttattccattaacacagataaattagataatttctacaaaaaagtaaaacagaacgga
gttactatgactgctttactagtaaaggcagttgcaaagacactaaagaaacatcctcaa
gttaactcaagtttttcagagaatggaatttcttatccagaaaatataaatattgctgtt
gctgttgcgatggaagatggtggactaataactccagttttaaaagaaccatgcaatact
gatttatttgaattgtctagggaatggaaagatctcgtaaaaagatcaagatcaaaacaa
ttagaacctgatgagtactctacgggaaccttcactttatctaaccttgggatgtttgga
gttgatagatttgacgcaattcttcctccaggtaccggtgcaattttagccatagcttca
tcgaaaccaaccgttgttgctaatagtgatggttcaatatctgttaaaaaaataatgcaa
gtaaatctaacagctgatcatagagtgatctatggagctgatggagcttcattcttaaaa
gacttggcttccctaattgaagatgagccagagactcttgtctcctaa

DBGET integrated database retrieval system