KEGG   Prochlorococcus marinus MIT 9301: P9301_04921Help
Entry
P9301_04921       CDS       T00488                                 

Gene name
gmk
Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
pmg  Prochlorococcus marinus MIT 9301
Pathway
pmg00230  Purine metabolism
pmg01100  Metabolic pathways
Module
pmg_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pmg00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    P9301_04921 (gmk)
Enzymes [BR:pmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     P9301_04921 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 Rad17 RsgA_GTPase AAA_16 NTPase_1 AAA_22 AAA_17 AAA_14 NB-ARC AAA AAA_29 MMR_HSR1 ABC_tran
Motif
Other DBs
NCBI-ProteinID: ABO17115
CYORF: P9301_04921
UniProt: A3PBJ0
Position
430245..430799
Genome map
AA seq 184 aa AA seqDB search
MKNQKKLIILTGPSGVGKGTVVKEILCKEKNFWLSISATTREPREGEKDGENYYFLNQEK
FKEMIEQNLFLEWAQFAGNYYGTPLSSVNEKIKKGFTVLLEIEVEGARQIKNKFPNSQSI
FLLPPDKEELERRIRNRGTEKEEAIKKRLSRANYEISASNEFDFALTNHNVDETAKKIIK
LIKT
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatcaaaaaaaacttattatccttactggacccagcggggtaggtaaaggaaca
gttgttaaagaaatattatgtaaagaaaaaaatttttggctttctatatctgcaactact
agagaacctagagagggagagaaagacggagaaaattattatttcttaaaccaagaaaag
tttaaagaaatgattgaacaaaaccttttccttgaatgggctcaatttgctggaaactac
tatggaacgcctttgtcttcagttaatgagaaaataaaaaagggatttaccgtacttctt
gaaattgaagtagagggtgcaaggcaaataaaaaataagtttcctaattcacagtcaata
tttttgcttcctccggataaagaagagttagagagaagaataagaaatagaggtacagaa
aaagaagaggcaattaaaaaaagactctcaagggctaattatgagatttcagcatcaaat
gaatttgattttgcattaacaaatcacaatgttgatgaaacagcaaaaaaaataatcaag
ttaataaaaacttga

DBGET integrated database retrieval system