KEGG   Prochlorococcus marinus MIT 9301: P9301_04921Help
Entry
P9301_04921       CDS       T00488                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.12 2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
pmg  Prochlorococcus marinus MIT 9301
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:pmg00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
430245..430799
Genome map
AA seq 184 aa AA seqDB search
MKNQKKLIILTGPSGVGKGTVVKEILCKEKNFWLSISATTREPREGEKDGENYYFLNQEK
FKEMIEQNLFLEWAQFAGNYYGTPLSSVNEKIKKGFTVLLEIEVEGARQIKNKFPNSQSI
FLLPPDKEELERRIRNRGTEKEEAIKKRLSRANYEISASNEFDFALTNHNVDETAKKIIK
LIKT
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatcaaaaaaaacttattatccttactggacccagcggggtaggtaaaggaaca
gttgttaaagaaatattatgtaaagaaaaaaatttttggctttctatatctgcaactact
agagaacctagagagggagagaaagacggagaaaattattatttcttaaaccaagaaaag
tttaaagaaatgattgaacaaaaccttttccttgaatgggctcaatttgctggaaactac
tatggaacgcctttgtcttcagttaatgagaaaataaaaaagggatttaccgtacttctt
gaaattgaagtagagggtgcaaggcaaataaaaaataagtttcctaattcacagtcaata
tttttgcttcctccggataaagaagagttagagagaagaataagaaatagaggtacagaa
aaagaagaggcaattaaaaaaagactctcaagggctaattatgagatttcagcatcaaat
gaatttgattttgcattaacaaatcacaatgttgatgaaacagcaaaaaaaataatcaag
ttaataaaaacttga

DBGET integrated database retrieval system