KEGG   Prochlorococcus marinus MIT 9301: P9301_05981Help
Entry
P9301_05981       CDS       T00488                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pmg  Prochlorococcus marinus MIT 9301
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    P9301_05981 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    P9301_05981 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    P9301_05981 (trpA)
Enzymes [BR:pmg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     P9301_05981 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
523348..524190
Genome map
AA seq 280 aa AA seqDB search
MKDNKMQITKNESLSKVDEKFFDLKNNKKLALMPFIMAGDPNIEITSEILLRLQENGADL
IELGIPYSDPLADGPIIQVSASRALKSGTSPRKVIKLLESLKGKLNIPIILFSYLNPLLC
FGFEKFCEMASNAGVSGLIVPDLPLEEAYKFSKVVSNHSMDLILLVAPTTPFERMKQISN
HTKGFTYLVSVTGVTGERNKMENRVENLIAKLKDVNSNPIAVGFGISTPEHVNKVREWGA
DGVIIGSAFVKRISSSSEKDVVDHVGEFCKEMRLAADQKK
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacaacaaaatgcaaattactaaaaatgaatctttatctaaggtagatgagaag
ttttttgacttaaaaaataataaaaaattagctttgatgccttttataatggctggtgat
cccaatattgaaatcacgtctgagattttattaaggttacaagaaaacggggctgacctt
atcgaattaggtataccttacagtgacccacttgcagatggacctattattcaagtgtcg
gcctctcgcgccttaaagtcaggtactagcccgagaaaagttattaaacttttagagtct
ttaaaaggtaaattaaatattcccatcatccttttttcttacctaaatccattactatgt
tttggctttgaaaagttttgtgagatggcatctaatgctggagtttcaggactaatagtt
cctgatctccccctagaggaagcttataaattttctaaagtagttagcaatcattctatg
gacttgattttattggtagctccaactactccttttgaaagaatgaaacaaatatctaat
catacaaaaggctttacttatttagtaagtgtcacaggtgtcactggtgagagaaataaa
atggaaaatagggtagaaaatcttattgctaaattaaaagatgtaaatagcaatccaatt
gctgttggttttggaatatccactccagaacatgttaataaagttcgtgagtggggagca
gatggagtaattattgggagtgcatttgtaaaacgaatttctagttcaagtgaaaaagat
gtcgtcgatcatgttggtgaattttgtaaggaaatgcgtttagctgcagatcaaaaaaaa
taa

DBGET integrated database retrieval system