KEGG   Prochlorococcus marinus MIT 9301: P9301_06221Help
Entry
P9301_06221       CDS       T00488                                 

Gene name
glk
Definition
(GenBank) Putative glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
pmg  Prochlorococcus marinus MIT 9301
Pathway
pmg00010  Glycolysis / Gluconeogenesis
pmg00052  Galactose metabolism
pmg00500  Starch and sucrose metabolism
pmg00520  Amino sugar and nucleotide sugar metabolism
pmg00521  Streptomycin biosynthesis
pmg01100  Metabolic pathways
pmg01110  Biosynthesis of secondary metabolites
pmg01120  Microbial metabolism in diverse environments
pmg01130  Biosynthesis of antibiotics
pmg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    P9301_06221 (glk)
   00052 Galactose metabolism
    P9301_06221 (glk)
   00500 Starch and sucrose metabolism
    P9301_06221 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    P9301_06221 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    P9301_06221 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    P9301_06221 (glk)
Enzymes [BR:pmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     P9301_06221 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK mIF3
Motif
Other DBs
NCBI-ProteinID: ABO17245
CYORF: P9301_06221
UniProt: A3PBX0
Position
complement(549579..550613)
Genome map
AA seq 344 aa AA seqDB search
MNFLACDLGGTKVLLGIFKKEINNNPPKLIFKKKYISSDWGSFELILEDFIKKECKNITH
PSSACFAVAGPLSKNNAKIVNLSWNISGNDLQNKFNLKNCELINDFAVQIYGIPFLKKNQ
YSTIQNGSNSEDTNNDLHVIVGAGTGLGIARGIISGEKVKVLASEGGHVEYSPKSKLEWD
LKIWLKNYLKVERISCERIVSGTGLSRIAEWRLSKPDAQNHPLQKYLKKIKIFDAARKEL
PEKICNLSKEGDQLMIEVERIWLGAYASLLGDVALQELCFGGLWISGGTASKHFKNFKSD
LFLKQFFDKGRLKDILKTIPIKVILDEEFGLFSAACRAKMLLKT
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaattttcttgcttgtgatttaggaggtacaaaggttctattaggaattttcaaaaaa
gaaataaataataatccgcctaagttaatatttaaaaagaaatatatatcgtctgattgg
ggttcttttgaattaatcctagaagactttatcaaaaaagaatgcaagaatattactcat
ccttcttctgcatgtttcgctgtagctggtcctttatctaaaaacaacgcaaaaatcgtt
aacttgtcatggaatatttctggaaatgatttacagaacaaatttaatttaaaaaactgc
gagctaataaatgatttcgctgtacaaatttatggaataccttttttaaaaaaaaatcaa
tattctactatccaaaatggatccaattctgaagatactaataatgatttgcatgtcatt
gttggagcggggactggcttagggattgcaagaggaataatatcaggggaaaaggtaaaa
gttttagctagtgaaggtggtcatgtagagtactccccaaagtcaaaattagaatgggat
ttgaaaatttggcttaagaattacctaaaagttgaaaggatatcttgtgaaagaattgtt
agcggcactggtttatcaagaattgccgaatggaggctaagcaaacctgatgcccaaaac
catcctttacaaaaatatttaaaaaaaattaaaatttttgatgctgcgagaaaagaacta
cctgaaaaaatttgtaatctttctaaagaaggtgatcagctaatgattgaagttgagagg
atttggttaggcgcttatgcctcattattgggagatgttgctcttcaagaattgtgcttt
ggtggattatggatttctggaggaactgcgtcaaaacatttcaaaaactttaaatcagac
ttatttttaaaacaatttttcgacaagggaagattaaaagatattcttaaaacaatacct
ataaaagtaattttagatgaagagtttggactttttagtgcagcctgcagagcaaaaatg
cttttaaaaacttaa

DBGET integrated database retrieval system