KEGG   Prochlorococcus marinus MIT 9301: P9301_09161Help
Entry
P9301_09161       CDS       T00488                                 

Gene name
ruvA
Definition
holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pmg  Prochlorococcus marinus MIT 9301
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pmg00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    P9301_09161 (ruvA)
Enzymes [BR:pmg01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     P9301_09161 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(788678..789355)
Genome map
AA seq 225 aa AA seqDB search
MISWINGDLVDLWQTNQKFFVLINCQGLGYEIQILESFFLKLRKNQISTKNITLWVKHIK
KEDSDLLFGFTSNEQKNFFIEILSIRGVGSQIGIGILNKFSISEVINAIKTQDKKLICSV
PGIGQKMSERLILELKSKFKSEILSEEEKSKGELEIKDPEINKMIEDLQLTLQSLSYKNK
EINNILPIIIKEIDLLGKKENNLSFEKLLKLAMRYLDEDSSNIAR
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
ttgattagttggataaatggagatttagttgatttatggcaaactaatcaaaaatttttt
gttttaataaattgtcaaggattaggatacgaaatacaaatactagaatccttttttctc
aaattaagaaaaaatcagatatctactaaaaacatcactctttgggtaaagcatataaaa
aaagaagattcagatttattatttggctttacatcaaatgagcaaaagaatttctttatt
gaaattttaagtattcgaggtgttggatctcaaattggtattgggatattaaacaaattt
tctattagtgaagttataaatgcaataaaaacacaagacaaaaaattaatatgttctgta
cctggtataggacaaaaaatgagtgagcgtttaattttagaattaaaaagtaaatttaaa
agcgaaatattatctgaagaagaaaaaagcaaaggtgaacttgagattaaggatcctgaa
ataaataaaatgatagaagaccttcagttaacccttcaatcattaagttacaaaaacaaa
gaaataaataacattttgccaattattattaaagaaattgatctcttaggtaaaaaagaa
aataatttatcatttgaaaaactattgaaattagctatgcgttatctagatgaggatagt
agtaatatagctagatga

DBGET integrated database retrieval system