KEGG   Prochlorococcus marinus MIT 9301: P9301_09261Help
Entry
P9301_09261       CDS       T00488                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pmg  Prochlorococcus marinus MIT 9301
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:pmg00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
796714..797649
Genome map
AA seq 311 aa AA seqDB search
MQDLAKPKIKIKSPAKINLHLEVIGKREDGFHELAMIMQNIDLSDYLEFEINNEGLIKLE
SDCNDLSLSDDNLIVKSANLLRKNSNINYGANIFLRKNIPIGAGLAGGSSNAAATLIGLN
KLWNLDLDHGTLCSLASTLGSDIPFFINGGIQLCFGRGEILEKLDSNFEYGVILLKNPNV
SVSTAETYKKYSNRFCDNHLNDRKMIENIRKNLRDNGLNKLNFDNQHLFIKNDLQLVVEN
ENDSVKQALYLLSKLENCLTFSMSGSGPTCFALFKDIETAKKELTANSKFFKDKGYDSWV
CTFLEKGITFI
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgcaagatttagctaaaccgaaaattaagataaaatctcctgccaaaataaatttgcac
cttgaagttattggtaaaagagaggatggatttcatgagttagcaatgattatgcaaaat
atcgatctttctgattatttagaatttgaaataaataatgaaggtttaattaaacttgag
tctgattgtaatgatttaagcttgtctgatgataacttaattgttaaatcggcaaatcta
ttaagaaaaaattcaaatataaattacggtgcgaatatatttttaagaaaaaatattcca
attggcgcaggattagctggtggatccagtaatgcagcagcaacattaattggtcttaat
aagttatggaatttggacttagatcatggaacattatgttcattagcatcaactttagga
tctgatattcccttttttataaatggtggcattcagttatgttttggaagaggagaaatt
ttggagaaattagattcaaactttgaatatggagtaattcttttaaaaaatccaaatgta
tcagtatctacagctgaaacttataaaaaatatagtaatagattttgtgataatcatctt
aatgatagaaaaatgattgagaacataagaaaaaatttaagggataatggtttgaataaa
ttaaattttgataatcaacatttatttattaaaaatgatttgcagttagttgttgaaaat
gaaaatgattctgtaaagcaggcattatatttactttctaaactagaaaattgtctcaca
ttttcaatgagtggatcaggacctacatgctttgcactctttaaagatatagagactgca
aaaaaagaattaactgctaattctaaattttttaaagataaaggctatgattcatgggtt
tgcactttccttgaaaagggaataacattcatttaa

DBGET integrated database retrieval system