KEGG   Prochlorococcus marinus MIT 9301: P9301_10411Help
Entry
P9301_10411       CDS       T00488                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pmg  Prochlorococcus marinus MIT 9301
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pmg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    P9301_10411 (tpiA)
   01230 Biosynthesis of amino acids
    P9301_10411 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    P9301_10411 (tpiA)
   00051 Fructose and mannose metabolism
    P9301_10411 (tpiA)
   00562 Inositol phosphate metabolism
    P9301_10411 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    P9301_10411 (tpiA)
Enzymes [BR:pmg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     P9301_10411 (tpiA)
Exosome [BR:pmg04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   P9301_10411 (tpiA)
  Exosomal proteins of bladder cancer cells
   P9301_10411 (tpiA)
  Exosomal proteins of melanoma cells
   P9301_10411 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(901889..902614)
Genome map
AA seq 241 aa AA seqDB search
MRKSVIAGNWKMHMTCAEAKSYLEEFIPLIKNIKDDRKVVIAPPFTAISTFSDHSDFEYL
DISSQNIHWEDQGAFTAEISPKMLLEHGVSYAIVGHSEPRKYFSESDEQINKRAVFAQSS
GLTPIVCVGETLEQRERGEADRVITRQVEQGLENTDPSNLIVAYEPIWAIGTGKTCEAED
ANKICSLIRKLIGFDDVIIQYGGSVKPNNIDEIMSMSDIDGVLVGGASLDPNSFARIANY
Q
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
ttgagaaaatctgtaattgctggtaattggaaaatgcacatgacttgtgctgaagctaaa
tcctatttagaagagtttattcctttaataaaaaacattaaagacgatcgtaaagttgtt
attgctccaccttttacggctatttcaaccttttctgatcattctgattttgaatattta
gatatttctagtcaaaatattcattgggaagatcaaggagcgtttacggcagaaatatcc
cccaaaatgcttcttgaacatggtgtctcatatgcaatcgttggacatagtgaaccaaga
aaatattttagtgaaagtgatgagcaaattaacaaaagagcagtttttgctcaatcaagt
ggacttactccaatagtttgtgtaggagaaacattagaacaaagagagagaggagaggct
gatagagttattactagacaggttgaacaaggattagaaaatacagatccatctaattta
attgttgcctatgaaccaatatgggctattggcactggtaaaacgtgtgaggcagaagac
gctaataagatatgttctttgattcggaaattaataggttttgatgatgtaattattcaa
tatggaggatctgttaagcctaataatatcgacgaaatcatgtcaatgagtgatatcgat
ggggtgctagtcggaggggcttcattagatccgaatagtttcgcgagaattgcaaattat
caataa

DBGET integrated database retrieval system