KEGG   Prochlorococcus marinus MIT 9301: P9301_12041Help
Entry
P9301_12041       CDS       T00488                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
pmg  Prochlorococcus marinus MIT 9301
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pmg00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    P9301_12041 (recR)
DNA repair and recombination proteins [BR:pmg03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      P9301_12041 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1018124..1018723)
Genome map
AA seq 199 aa AA seqDB search
MITYTKPLSKLIGHFEKFPGIGPRTAQRLALFILKQPESTIREFSKALLEAHSNVGRCKK
CFNLTSEDECEICRNTERNQKLICVVAETKDLLALERAREFKGVYHVIGGLISPMDSVGP
ELLEIRSLVERVSKSEIDEIILALTPSVEGDTTSLYIGKLLAPFTKVTRIAYGLPMGSEL
EYVDEVTLARALEGRTKLN
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttgattacttataccaaaccactttcaaaattaatcggtcattttgagaaattcccaggg
attggtccaagaacagcgcaacgattagccctgtttattttaaaacaacctgaaagcaca
ataagagaattttcaaaggctctgttagaagcacatagtaatgtgggtcgttgcaaaaaa
tgtttcaatttgacttcagaagatgaatgcgaaatatgtagaaatactgaaagaaatcaa
aaactaatctgtgtagtagcagaaacaaaagatttacttgctttggagcgcgccagagaa
tttaaaggtgtttaccatgttattggtggtttaatatccccaatggattctgttggccct
gaactcttagaaataagaagcttggtagaaagagtaagtaagtctgaaatagatgagatc
atattggcattgaccccaagtgttgagggagatacaacaagtctttatattggaaaattg
ttagctccttttactaaagttacgaggattgcatatgggcttccaatgggcagtgaactt
gaatatgtggatgaagttacacttgcaagggccttagaaggtagaacaaaactaaattag

DBGET integrated database retrieval system