KEGG   Prochlorococcus marinus MIT 9301: P9301_12091Help
Entry
P9301_12091       CDS       T00488                                 

Gene name
recD
Definition
(GenBank) possible exodeoxyribonuclease V 67 kD polypeptide
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
pmg  Prochlorococcus marinus MIT 9301
Pathway
pmg03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:pmg00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    P9301_12091 (recD)
Enzymes [BR:pmg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     P9301_12091 (recD)
DNA repair and recombination proteins [BR:pmg03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     P9301_12091 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 Viral_helicase1 UvrD_C_2 AAA_11 Helicase_RecD PhoH DUF2075 UvrD-helicase AAA_16 UvrD_C NTPase_1 AAA_22 RsgA_GTPase AAA AAA_5 NACHT DnaB_C AAA_24 Zeta_toxin AAA_25 AAA_33 AAA_28 AAA_14
Motif
Other DBs
NCBI-ProteinID: ABO17832
CYORF: P9301_12091
UniProt: A3PDK7
Position
complement(1023406..1025109)
Genome map
AA seq 567 aa AA seqDB search
MTKTSTDIEKFQYDHIFNLILGIFKFSEKKYGNFVKDVIRILLEFEKNGETIIDVDNSLI
IFELLEDGWPNKHIDVLKNLGLIGSLDSPFVLVNRKLSLSKWSKKIERVINLFIKKIDTD
NLMNSIIYKDDNKIDQIKNIFKYSNLVFLQGGPGTGKTTLIIKLILELLQIDNFLNIGLS
APTGKATARLKEALNDKKNISFSKFLDQIEFQTLHRWILNSKNKSLTLKFKLKELDIFII
DEMSMVNIDLIESVLNLLAKDCKIILVGDKNQLSPVNNCSIWNYLFEYSDNSSIKSCVVN
LEKTYRNIGDIALISSLIFNNDFSLLNQKIKELEKDNNSKEITISKSRKKDIPKDLLFSI
TSHLKQLNISTSNLSKKKYIFDKCIDNLLLNEKDLVDKIFLDLQSHLILCEKNSGIWSVE
YLNEIVFGQKKPYDLKTLKEGIPIMCTKNNNELGLSNGDIGVLIGLENKRKYLFRKFNDN
NEEIVTLIDPSNLENVVPAIAITIHKSQGSESEKVNILWSQNYRRNQYAVKEKKDSQNSF
CRDNFERRLFYTAVTRAKKSLNIYYLN
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaacttccactgatattgaaaagttccaatacgatcatatatttaatttaatt
ttaggtattttcaaatttagtgaaaaaaaatatggaaatttcgtaaaagatgtaataaga
attttattagagtttgaaaaaaatggtgaaactattattgatgttgataatagtttaata
atctttgaattattagaggatggctggcccaataaacatatagatgttttaaaaaattta
ggtttgattggttcccttgattctccattcgtattagtaaatagaaaattatccttatca
aaatggtcaaaaaagatagaaagagttattaatttatttataaaaaaaatagataccgat
aatttaatgaactcaataatttataaagatgataataaaattgatcaaattaaaaatata
tttaaatattcaaacttagttttccttcaaggaggaccaggcacgggtaaaaccacttta
ataataaagttaatactagaactgcttcaaattgataactttttaaatattggtttgtct
gctccaactggtaaagctacagctcgtttaaaagaagcccttaatgataaaaaaaatatt
tcctttagcaaatttctagatcagatagaatttcaaactttacatagatggattttaaat
tctaaaaataaatctcttactttgaaatttaaactaaaagagcttgatatttttataatt
gatgaaatgtcaatggttaatatcgatttgattgaatcagttttaaatttgctagcaaag
gattgtaaaattattttagttggtgataaaaatcaattgtctccagtaaataactgttct
atatggaattatttgtttgaatattccgacaatagttcaattaaatcttgtgtagtaaat
ttagaaaaaacttatagaaacattggagatatagcattaattagtagtttaatatttaat
aatgatttttctttacttaatcaaaagataaaagaattagaaaaagataataattcaaaa
gaaattactatttcaaagagtagaaaaaaagatattccaaaagatctattattttcgatt
acaagtcatctaaaacagttaaatatttcaacttcaaatttaagtaaaaaaaaatatata
tttgataagtgtattgataatttgttgcttaatgaaaaagatttagtagataagatattt
ctggatttacaaagtcacttaattttatgcgaaaaaaattccggaatatggagtgttgaa
tatttgaatgaaattgtttttggtcaaaaaaaaccctatgaccttaaaactcttaaagag
ggtattccgatcatgtgtacaaaaaataataatgaactaggattgtcaaatggggatatc
ggagtacttataggtttagaaaataaaagaaaatatctttttagaaaatttaatgataat
aacgaagaaattgtcacattaattgatccatctaatttagaaaatgttgtaccagcaata
gccattactattcataaatctcaaggaagtgaatctgaaaaagtaaacattttgtggtcc
caaaactatagaagaaatcaatatgctgtaaaagaaaaaaaagatagtcaaaatagcttt
tgcagagataattttgaaagaaggttattttatactgctgttacaagagcgaaaaaatct
ttaaatatatattatttaaattaa

DBGET integrated database retrieval system