KEGG   Prochlorococcus marinus MIT 9301: P9301_13931Help
Entry
P9301_13931       CDS       T00488                                 

Gene name
cysQ
Definition
CysQ-like protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
pmg  Prochlorococcus marinus MIT 9301
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pmg00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    P9301_13931 (cysQ)
Enzymes [BR:pmg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     P9301_13931 (cysQ)
Transfer RNA biogenesis [BR:pmg03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    P9301_13931 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1161407..1162309)
Genome map
AA seq 300 aa AA seqDB search
MIKLPSGIELQNLIDNLRILSWEASEKLTYYAQIVKDSNGKRNILRNDNFEDPVTLADIS
VNEIVINKINQLYKDVNWKILSEENVKSGPYNPNINQDWVWILDPLDGTKDFIQGTTNYA
MHLALNYKKRPLIGIVLIPERDELWFAVGCELWCENRNGVRIKPKPLKRKSLQEMSLVTS
KNHGNTTLNKLIKKINFKEVIIMGSIGCKIASIVRRDSDIYICLSLPGMSSPKDWDFAAP
EAILKASGGNITTLDNKDLIYGKSNFEQGGIIVASNNINNHKNICSEIEEIIREGDLFPL
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
gtgattaagttaccttcaggcatagagttgcaaaatcttatagataatttgaggatttta
agctgggaagcttctgaaaagttaacttattatgctcaaatagtaaaagattcaaacggt
aaacgcaatattttaagaaatgataattttgaggatccagttactcttgctgacattagt
gtaaatgagatagtaattaataaaattaaccaattatataaagacgttaattggaaaatc
ttgagtgaagaaaacgtaaaatctggaccttacaatcctaatataaatcaagattgggtt
tggattctcgaccctcttgatggaacaaaggattttatacaaggtactactaattatgct
atgcatctagctttgaattacaaaaaaagacccttaataggtatcgtattaatacctgag
agggatgaattgtggttcgctgtgggatgtgagttatggtgtgagaatagaaatggagtc
agaataaaacctaaacctttaaaacggaagagtcttcaagagatgtctttagttactagt
aagaatcatgggaatacaactttaaataaattaattaaaaaaattaatttcaaagaggta
ataataatgggaagtataggttgtaagattgcctcaatcgtcagaagagatagtgacata
tatatttgtctgagtttgcctggaatgtcatcccccaaagattgggattttgctgcgcct
gaagctatcttaaaagctagtggcggcaatattacaactttggataataaagatttaatc
tacgggaaatctaattttgaacagggtgggataatcgtggcatctaataatattaataat
cataaaaacatttgttctgagatagaggaaataatcagagaaggtgatttatttcctctt
tga

DBGET integrated database retrieval system