KEGG   Prochlorococcus marinus MIT 9301: P9301_14291Help
Entry
P9301_14291       CDS       T00488                                 

Definition
glutamine amidotransferase
Orthology
K02501  
glutamine amidotransferase [EC:2.4.2.-]
Organism
pmg  Prochlorococcus marinus MIT 9301
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pmg01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:pmg00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1197577..1198194
Genome map
AA seq 205 aa AA seqDB search
MNPKVGIIDYNCGNLGSITKAFSFIGCETKILRDNDKNNCSHLVLPGVGSFKKGSDYIFK
ISKSIEEITLSHFAMERPLLGICLGYQLFSKGGTEGGQSKGFGFLDADCEHLSKIIDPNE
IKIPNVGFQKLSYDSSELNLKDNCYYFVHSYALRFKNPPQNVQKIIIGGEELIIGFQHKN
LWGFQFHPEKSQLKGLDLLRKFISL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaatcctaaggttggaataattgactataactgtggcaatttaggctccataacaaaa
gctttttcatttattggctgcgaaacgaaaatcctaagagataatgataaaaataattgt
tctcatcttgttttgccaggagtcggatcatttaaaaaaggatctgactatatctttaaa
atatctaaaagtatagaagaaataacattatctcactttgcaatggagaggcctctactg
ggtatatgtttaggttaccaacttttttcaaaaggaggaacagaaggggggcaatcaaaa
ggattcggttttttagatgcggattgcgaacatttaagcaaaataattgatccaaatgaa
ataaaaataccaaatgtaggatttcaaaaattatcttatgattcttcagaactaaactta
aaagataattgctattattttgttcatagttatgctttaagatttaaaaacccaccccaa
aatgttcaaaagataattattgggggagaagaattaattataggttttcaacataaaaac
ctctggggctttcagtttcatccagaaaaaagtcaactaaaaggtttggatttacttaga
aaatttatttctttataa

DBGET integrated database retrieval system