KEGG   Prochlorococcus marinus MIT 9301: P9301_16791Help
Entry
P9301_16791       CDS       T00488                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23 1.1.1.37)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
pmg  Prochlorococcus marinus MIT 9301
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    P9301_16791 (hisD)
  Amino acid metabolism
   00340 Histidine metabolism
    P9301_16791 (hisD)
Enzymes [BR:pmg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     P9301_16791 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1410728..1412014
Genome map
AA seq 428 aa AA seqDB search
MKIINNKTEAIEELKRISTRTNSENNNKINKIVEEILQEVKISGDNAVEKYTKKFDGFDP
NPMQVNADQIKNAWDEIDNNLKRSLEEAHKRIQKFHEKEIPQSFTIKGEYGDIVQRRWKP
VKNAGIYIPGGRAAYPSTVLMNAIPAKVAGVAEIIMVSPGNKEGEINKTVLAAAHLSGIN
KVFRIGGAQAIGALAFGTNQINKVDVISGPGNIYVTTAKKLIYGSTGIDSLAGPSEILII
ADETAQSTHIASDLLAQAEHDPLASSILLTTSKNQAKEVLEELYKKIEDHPRKEICMQSI
NNWGSIVICENSEQCVELSNNFAPEHLEILTVDPKKILAGIENAGAIFLGKWTPEAVGDY
LAGPNHTLPTSGNSRFSGSLGVETFMKNSSIIEFNEESLKVNSLDIINLAKSEGLHSHAN
SVQIRFED
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaagataataaataataaaacagaagctattgaagaattgaagaggatttctacccga
actaattcagaaaataataataagataaataaaattgttgaagaaattcttcaagaggta
aaaatttctggagataacgcagttgaaaaatataccaaaaaatttgatggtttcgatcct
aaccctatgcaagtgaatgcggatcaaataaagaatgcatgggatgaaattgataacaat
ttgaaacgctcacttgaggaggctcacaaaagaattcaaaaattccatgaaaaagaaatt
cctcaatctttcacgataaaaggtgaatatggtgatattgtccaaagaagatggaaacca
gttaaaaatgcaggtatttatattcctggaggaagagctgcttatccaagtactgtatta
atgaatgcaattcctgcaaaagtagcaggagtagctgaaattataatggtatctcctgga
aataaagaaggggaaataaacaaaactgttttagctgcagctcacttatcaggtatcaat
aaagtatttagaattggaggagctcaagcgattggtgcattagcatttggcacaaatcaa
atcaacaaagttgatgttatatcaggtccagggaatatatatgttacaactgcaaaaaaa
ctaatttatggctcaacaggaattgattcattagctggtccaagtgaaatattaatcatt
gcagatgaaacagctcaaagcactcatatagcatctgatctactagcgcaagcagaacat
gatcctttggcttcatcaatactactaactacatcaaagaaccaggcaaaagaagtttta
gaagaactttataaaaaaattgaggaccatccaagaaaagaaatttgcatgcaatcaatc
aacaattggggttcaattgtgatttgcgagaattctgaacaatgtgttgaactaagcaat
aactttgcccctgaacacctagaaattcttactgtagatccaaaaaaaattcttgcaggt
atagagaatgcaggagcaatttttttaggaaaatggactccagaagctgttggagattat
cttgctggaccaaatcatactttacccacatcaggtaattctagatttagcggttcttta
ggggttgaaacttttatgaaaaattcttcaataatagaatttaatgaagaaagtttaaaa
gttaatagccttgatattattaatctagctaaaagtgagggcttgcatagtcacgctaac
tcagtacaaataagatttgaagattag

DBGET integrated database retrieval system