KEGG   Prochlorococcus marinus MIT 9301: P9301_18111Help
Entry
P9301_18111       CDS       T00488                                 

Definition
(GenBank) two-component response regulator
Organism
pmg  Prochlorococcus marinus MIT 9301
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1533412..1534158)
Genome map
AA seq 248 aa AA seqDB search
MSKARILVVDDEPAVLKVLVTRLQLAGYQVYSATNGEEAIESFHRDSPDLIVLDVMLPKM
DGFAVCRRIRAESVVPIIFLTALEAISERVAGLDLGADDYLSKPFSPKELEARIATILRR
MGPSISVTETKEVPSGKGVMKFGSLVVDTNRRQVSRAGDRISLTYTEFSLLELLFDEPGK
VVPRAEILEQLWGYPPRRAADLRVVDVYVARLRGKLEPDPRNPELILTVRGIGYASQRVG
ETATSLAS
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagcaagaattttagttgttgatgatgaaccagcagttttgaaggtattagtt
acaaggcttcaactagctggatatcaagtttattcagccactaatggcgaagaagctatt
gaatctttccacagggattcgccagatttaatagttcttgatgttatgcttccaaaaatg
gatggatttgctgtttgtagaagaattagagctgaatcagtagtaccaataatattttta
accgctctagaggctatttcagagagagtcgcaggcttggatttaggggctgatgattac
ttatctaaaccatttagtccaaaagagttagaggctaggatagctactattttgagaaga
atgggcccaagtatatcggttactgaaaccaaagaagttccttcaggtaaaggagttatg
aaatttggaagtttagttgttgatactaatcgcagacaagtttctagagctggagataga
attagtctaacttatactgaatttagtctcctagaattattatttgatgagcctgggaaa
gttgtaccgcgagcagaaatattagaacagctgtggggttatcctcctcgtagagctgct
gatttaagagttgtagatgtatacgttgctagattaagaggtaagttggaaccagatcca
agaaatccagaattaatattaactgttagagggattggttacgcatcccagagagttggt
gaaacagcaacatctttggcaagttga

DBGET integrated database retrieval system