KEGG   Prochlorococcus marinus MIT 9301: P9301_18161Help
Entry
P9301_18161       CDS       T00488                                 

Gene name
dedA
Definition
DedA family alkaline phosphatase-like protein (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
pmg  Prochlorococcus marinus MIT 9301
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pmg00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:pmg00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:pmg02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1537164..1537823)
Genome map
AA seq 219 aa AA seqDB search
MNLIFVNFLTSIPDYISLAVEKNSAVAYLTICLAMFLENIIPPIPSEIIMPLGGFFVYQE
KLNFYILIFWGLLGTILGSLPWYYLGRLVNEKRLANFLDNKGKYLGISSKDLMKSKMWFE
KYGVSLVFWGRLVPGIRTLISVPAGIELMPVRKFLIWTTFGSFIWVALLTYAGFLFGENY
PIIKTYIDQIKIFVKPILILLFLYFFIKIISRFIKKNRA
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
ttgaacttaatttttgtaaattttcttacctcgattcccgattatataagtttggcggtt
gagaagaattctgctgttgcataccttactatatgtttggctatgtttttagaaaatata
attcccccaatcccatcagaaataataatgcccttgggaggcttttttgtttatcaagaa
aaattaaacttttatattttaattttctggggtttattgggaacaatactaggttcattg
ccttggtattacttaggcagattagtaaatgaaaaaagacttgcaaattttcttgataat
aaagggaaatacttgggaatttcttctaaagatttaatgaaaagtaagatgtggtttgag
aaatatggggtttcactggtgttttggggacgattagtaccaggtataagaacgttaatt
tcagttcctgctggcatagaacttatgccagtaagaaaatttttgatttggactacattt
ggtagttttatatgggtagcgcttctcacttatgcaggttttttattcggtgaaaattac
ccaattatcaaaacttacattgatcaaatcaagatttttgtaaaaccaattttaatttta
ctttttttatatttttttatcaaaataattagtagatttataaagaaaaatagggcttag

DBGET integrated database retrieval system