KEGG   Prochlorococcus marinus MIT 9301: P9301_18191Help
Entry
P9301_18191       CDS       T00488                                 

Definition
carbohydrate kinase (EC:2.7.1.45 2.7.1.4)
Orthology
K00847  
fructokinase [EC:2.7.1.4]
Organism
pmg  Prochlorococcus marinus MIT 9301
Pathway
Fructose and mannose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pmg00051]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pmg00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pmg00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1539691..1540689)
Genome map
AA seq 332 aa AA seqDB search
MKNKKVICIGEALIDRIRNKSNQGFTDFLGGAPANVACALRKLKIDSVFIGCLGSDDYGK
KFITQFNKLDVNLDFLQLDNDSSTRVVNVDRDQFGERFFSGFEESSYSCFADEVLSKKLI
AKQILNLEKSFLETKYLVTGTILLSSPISSETIFFLLEGAKAFDVKIVIDLNWRQVFWDH
SSFSSEISQATRVNLIKKFLNHANVLKLAKEEATLFFEDENPFLISQQLSNRPDVIITDG
KNPVTWYINGLQGITETPSSQEIVDTTGAGDAFLAGLISKLISSGYPSNEQEIEDCIKFA
GACGLLTCLGEGAIEQQPYYENVNKFLGSLIS
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaataaaaaggtcatatgtattggagaggctttaattgacagaatcagaaataag
tctaatcaaggatttacagattttttaggtggggccccagcgaatgttgcttgtgcatta
agaaaattaaaaatagattcagtatttataggatgtttgggtagtgatgattatggaaaa
aaatttattacgcaatttaataaattggacgttaatttagatttcttgcaattggataat
gattcatctactcgcgtagttaatgtagatagagatcaatttggagaacgttttttttcg
ggctttgaggaaagttcttattcatgctttgcagacgaagttcttagtaagaaattaatc
gcaaaacaaattttaaatttggagaaatcttttctagaaacaaaatatctggttacagga
acgatcttattatcatctccaatatcatcagagactattttttttcttcttgaaggggct
aaagcatttgatgtaaaaatagttattgatttgaattggagacaggtcttttgggatcat
tcaagtttttcatcagaaattagtcaagccactagagttaatttaatcaagaaattttta
aatcatgcaaatgttttaaaacttgctaaggaggaagcaactttgttttttgaggatgaa
aatcccttcctaatatctcaacaattgtctaatagaccagatgtaataataactgatgga
aaaaatcctgttacatggtacataaatggtttgcagggaattaccgaaactccttcttcg
caagaaattgttgatacaactggagcaggagatgcttttttagctgggttaatttcaaaa
ttaatttcttctggttatccttcaaatgaacaagagatagaagattgcattaagtttgca
ggtgcttgtggattattaacttgtcttggtgaaggcgccatcgagcaacagccatattac
gagaatgttaataaatttttaggatctcttatttcatag

DBGET integrated database retrieval system