KEGG   Prochlorococcus marinus MIT 9301: P9301_18191Help
Entry
P9301_18191       CDS       T00488                                 

Definition
carbohydrate kinase (EC:2.7.1.45 2.7.1.4)
Orthology
K00847  
fructokinase [EC:2.7.1.4]
Organism
pmg  Prochlorococcus marinus MIT 9301
Pathway
Fructose and mannose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmg00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    P9301_18191
   00500 Starch and sucrose metabolism
    P9301_18191
   00520 Amino sugar and nucleotide sugar metabolism
    P9301_18191
Enzymes [BR:pmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     P9301_18191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1539691..1540689)
Genome map
AA seq 332 aa AA seqDB search
MKNKKVICIGEALIDRIRNKSNQGFTDFLGGAPANVACALRKLKIDSVFIGCLGSDDYGK
KFITQFNKLDVNLDFLQLDNDSSTRVVNVDRDQFGERFFSGFEESSYSCFADEVLSKKLI
AKQILNLEKSFLETKYLVTGTILLSSPISSETIFFLLEGAKAFDVKIVIDLNWRQVFWDH
SSFSSEISQATRVNLIKKFLNHANVLKLAKEEATLFFEDENPFLISQQLSNRPDVIITDG
KNPVTWYINGLQGITETPSSQEIVDTTGAGDAFLAGLISKLISSGYPSNEQEIEDCIKFA
GACGLLTCLGEGAIEQQPYYENVNKFLGSLIS
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaataaaaaggtcatatgtattggagaggctttaattgacagaatcagaaataag
tctaatcaaggatttacagattttttaggtggggccccagcgaatgttgcttgtgcatta
agaaaattaaaaatagattcagtatttataggatgtttgggtagtgatgattatggaaaa
aaatttattacgcaatttaataaattggacgttaatttagatttcttgcaattggataat
gattcatctactcgcgtagttaatgtagatagagatcaatttggagaacgttttttttcg
ggctttgaggaaagttcttattcatgctttgcagacgaagttcttagtaagaaattaatc
gcaaaacaaattttaaatttggagaaatcttttctagaaacaaaatatctggttacagga
acgatcttattatcatctccaatatcatcagagactattttttttcttcttgaaggggct
aaagcatttgatgtaaaaatagttattgatttgaattggagacaggtcttttgggatcat
tcaagtttttcatcagaaattagtcaagccactagagttaatttaatcaagaaattttta
aatcatgcaaatgttttaaaacttgctaaggaggaagcaactttgttttttgaggatgaa
aatcccttcctaatatctcaacaattgtctaatagaccagatgtaataataactgatgga
aaaaatcctgttacatggtacataaatggtttgcagggaattaccgaaactccttcttcg
caagaaattgttgatacaactggagcaggagatgcttttttagctgggttaatttcaaaa
ttaatttcttctggttatccttcaaatgaacaagagatagaagattgcattaagtttgca
ggtgcttgtggattattaacttgtcttggtgaaggcgccatcgagcaacagccatattac
gagaatgttaataaatttttaggatctcttatttcatag

DBGET integrated database retrieval system