KEGG   Prochlorococcus marinus MIT 9301: P9301_18191Help
Entry
P9301_18191       CDS       T00488                                 

Definition
(GenBank) Putative carbohydrate kinase
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
pmg  Prochlorococcus marinus MIT 9301
Pathway
pmg00051  Fructose and mannose metabolism
pmg00500  Starch and sucrose metabolism
pmg00520  Amino sugar and nucleotide sugar metabolism
pmg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmg00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    P9301_18191
   00500 Starch and sucrose metabolism
    P9301_18191
   00520 Amino sugar and nucleotide sugar metabolism
    P9301_18191
Enzymes [BR:pmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     P9301_18191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB DUF4434
Motif
Other DBs
NCBI-ProteinID: ABO18442
CYORF: P9301_18191
UniProt: A3PFB7
Position
complement(1539691..1540689)
Genome map
AA seq 332 aa AA seqDB search
MKNKKVICIGEALIDRIRNKSNQGFTDFLGGAPANVACALRKLKIDSVFIGCLGSDDYGK
KFITQFNKLDVNLDFLQLDNDSSTRVVNVDRDQFGERFFSGFEESSYSCFADEVLSKKLI
AKQILNLEKSFLETKYLVTGTILLSSPISSETIFFLLEGAKAFDVKIVIDLNWRQVFWDH
SSFSSEISQATRVNLIKKFLNHANVLKLAKEEATLFFEDENPFLISQQLSNRPDVIITDG
KNPVTWYINGLQGITETPSSQEIVDTTGAGDAFLAGLISKLISSGYPSNEQEIEDCIKFA
GACGLLTCLGEGAIEQQPYYENVNKFLGSLIS
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaataaaaaggtcatatgtattggagaggctttaattgacagaatcagaaataag
tctaatcaaggatttacagattttttaggtggggccccagcgaatgttgcttgtgcatta
agaaaattaaaaatagattcagtatttataggatgtttgggtagtgatgattatggaaaa
aaatttattacgcaatttaataaattggacgttaatttagatttcttgcaattggataat
gattcatctactcgcgtagttaatgtagatagagatcaatttggagaacgttttttttcg
ggctttgaggaaagttcttattcatgctttgcagacgaagttcttagtaagaaattaatc
gcaaaacaaattttaaatttggagaaatcttttctagaaacaaaatatctggttacagga
acgatcttattatcatctccaatatcatcagagactattttttttcttcttgaaggggct
aaagcatttgatgtaaaaatagttattgatttgaattggagacaggtcttttgggatcat
tcaagtttttcatcagaaattagtcaagccactagagttaatttaatcaagaaattttta
aatcatgcaaatgttttaaaacttgctaaggaggaagcaactttgttttttgaggatgaa
aatcccttcctaatatctcaacaattgtctaatagaccagatgtaataataactgatgga
aaaaatcctgttacatggtacataaatggtttgcagggaattaccgaaactccttcttcg
caagaaattgttgatacaactggagcaggagatgcttttttagctgggttaatttcaaaa
ttaatttcttctggttatccttcaaatgaacaagagatagaagattgcattaagtttgca
ggtgcttgtggattattaacttgtcttggtgaaggcgccatcgagcaacagccatattac
gagaatgttaataaatttttaggatctcttatttcatag

DBGET integrated database retrieval system