KEGG   Prochlorococcus marinus MIT 9301: P9301_18941Help
Entry
P9301_18941       CDS       T00488                                 

Definition
(GenBank) NAD binding site:D-amino acid oxidase
  KO
K00273  D-amino-acid oxidase [EC:1.4.3.3]
Organism
pmg  Prochlorococcus marinus MIT 9301
Pathway
pmg00260  Glycine, serine and threonine metabolism
pmg00330  Arginine and proline metabolism
pmg00472  D-Arginine and D-ornithine metabolism
pmg01100  Metabolic pathways
pmg01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pmg00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    P9301_18941
   00330 Arginine and proline metabolism
    P9301_18941
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    P9301_18941
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    P9301_18941
Enzymes [BR:pmg01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     P9301_18941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Pyr_redox_2 ApbA NAD_binding_9 AlaDh_PNT_C UDPG_MGDP_dh_N Pyr_redox HI0933_like FAD_binding_3 2-Hacid_dh_C NAD_binding_7 Pyr_redox_3 3HCDH_N Shikimate_DH Sacchrp_dh_NADP FAD_binding_2 NAD_binding_8 ThiF TrkA_N
Motif
Other DBs
NCBI-ProteinID: ABO18517
CYORF: P9301_18941
UniProt: A3PFJ2
Position
1624293..1625375
Genome map
AA seq 360 aa AA seqDB search
MKSLKENFQKANIVIIGAGIIGKFNALELSELGFQVTIIDPTQLKNSSNAALGLLMGNMY
QKRRGRSWNLRKQSIELWPQWIKFLQKFNYELNIEKPLIQLTTNEEKFKKLEKFVFENND
PTLLILERDSILIKNINKAFQTKNIKGIISFKDGRINALSLLQTLDKYLKHKKVNYLQGE
IIKIRKSNNQWISTTRNNENIKSDMVILCNSLKAIDLIDSRSHNIKLKPVLGQAIEIEIN
DAEVDLLSLPKQFNINGKNIISKSKNKLIIGSTDEYSTKPEKNTFEKLTNFLDKKPNWLE
KGKISKKWYGIRSRPDGEPSPIMKNLEDGLIICTGFYKNGFLLAPACSKWVANEIKNYLY
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcttaaaagaaaattttcaaaaagcaaacatagttattattggagccgggatt
attggaaaatttaacgctttagaattatcagaattaggtttccaggtaacgataatagat
ccaactcaactcaaaaatagtagcaatgcagctttgggtttgctaatgggtaatatgtat
caaaaaagaagggggagaagctggaatctcaggaaacaaagcattgaattatggccacaa
tggattaagttcctacaaaaatttaattatgaattaaatatcgaaaaaccattaatacaa
ctaactactaatgaagaaaagtttaaaaaattagagaaatttgtttttgaaaataatgat
ccaacgttattaattctagaaagagactcaatattaatcaagaatataaataaagccttc
caaacaaaaaatataaaaggaataatctccttcaaagatggaagaataaatgctttatcg
ttacttcaaacattagataaatatctaaaacataaaaaagtaaattatttacaaggagaa
ataataaaaataagaaaatcaaacaatcaatggatttctacaacaaggaataatgaaaat
atcaaatctgacatggttattttatgtaattcactaaaagcgattgacttaatagatagc
cgatctcacaacatcaaattaaagcctgttttaggtcaagctatagaaattgagattaat
gatgcagaagttgatttgttatcgctgccaaaacaattcaatataaatggtaaaaatata
atttcaaaatcaaaaaataagctaattattggatcaactgacgaatatagtactaagcca
gaaaaaaatacatttgaaaaactcacaaattttctcgataaaaaaccaaattggctagag
aaaggaaaaatttctaaaaagtggtacggaattaggtcaagaccagatggtgaaccttca
ccaataatgaaaaatcttgaagatgggctaattatatgtacaggtttttataaaaatggg
tttttattggctcccgcttgttctaaatgggttgctaatgaaattaaaaattacctttac
taa

DBGET integrated database retrieval system