KEGG   Prochlorococcus marinus MIT 9301: P9301_19061Help
Entry
P9301_19061       CDS       T00488                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pmg  Prochlorococcus marinus MIT 9301
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pmg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    P9301_19061 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    P9301_19061 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    P9301_19061 (thrC)
Enzymes [BR:pmg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     P9301_19061 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1640608..1641711
Genome map
AA seq 367 aa AA seqDB search
MVLLDKIKNKLRFNYRKKRWPGLIEAYKQYLPVTKKTPIISLNEGNTPLILSELISNLIG
NGTKVFLKYDGLNPTGSFKDRGMTMAISKAKEEGREAVICASTGNTSAAAAAYASRGGLK
PYVLIPEGFVAQGKLAQALMYGAEIISINGNFDKALEIVRDLSSEHPVELVNSVNPYRIQ
GQKTAAFEIVDDLGYAPDWLCIPMGNAGNITAYWMGFKEYSKIKKNLKLPIMMGFQSEGS
APLVKNIIVKDPETIATAIRIGNPVNREKAKKVRKESKGDFQSVTDKEIIDAYKILAKEG
VFCEPASAASVAGLIKNKNRIQKESTIVCVLTGNGLKDPDCAIKNNDAIFRKNIEPSLKN
ITKILGY
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggtgttattagataaaatcaaaaataaactgcgttttaattatagaaaaaaaagatgg
cctggccttatagaagcttataaacaatatctcccagtaacgaagaaaactcctattatt
tccctcaatgaaggaaatacaccactgatcttaagcgaattaattagcaacttaattgga
aatggaacaaaagtttttttaaaatatgatggccttaatccaacaggatcttttaaagat
cgtggtatgactatggcaattagcaaagcaaaagaagaagggcgtgaagcagttatttgt
gcaagcactggaaatacctctgctgctgctgctgcatatgcttcgagaggaggattaaaa
ccttatgtattaataccagaaggatttgttgcacaaggaaaacttgctcaagcattaatg
tatggcgctgagataatatctattaatggaaactttgataaggcccttgaaattgttaga
gatttatcctcagaacatccagtagaacttgttaattcggttaatccatatcgaatacaa
ggacaaaagacagcagcttttgaaatagttgatgacttaggttatgctcctgattggctt
tgtattccaatgggcaatgcaggaaatataactgcttattggatgggatttaaagagtat
tcaaaaattaaaaaaaatttgaaattaccaataatgatgggttttcaatccgaaggctct
gctccattagtaaaaaatataatagttaaagatccggaaacaattgcaactgcaatcaga
attgggaatcctgtaaatagagaaaaagcaaaaaaagtaagaaaggagagtaaaggagat
tttcagtcagttacagataaagaaataatcgatgcttataaaatccttgccaaagagggg
gttttttgtgaacctgccagtgcagcatcagttgctggactgattaaaaataaaaataga
attcagaaagaatcgactattgtttgtgttctgactggaaatggcttgaaagatcctgat
tgcgctattaaaaataatgatgctatttttaggaaaaatattgaaccttcattaaaaaat
ataactaaaatcttaggatattaa

DBGET integrated database retrieval system